StarFunc result for job id P14653

User Input

>input (301 residues)
MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQN
SGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQL
GGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTF
DWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATL
ELNETQVKIWFQNRRMKQKKREREEGRVPPAPPGCPKEAAGDASDQSTCTSPEASPSSVT
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14653	0.999	0.999	8.894E-43	301	1.000	1.000	P14653.pdb.gz	HXB1_HUMAN Homeobox protein Hox-B1 OS=Homo sapiens OX=9606 GN=HOXB1 PE=1 SV=2
2	AFDB:P17919	0.327	0.331	2.200E-33	297	0.857	0.869	P17919.pdb.gz	HXB1_MOUSE Homeobox protein Hox-B1 OS=Mus musculus OX=10090 GN=Hoxb1 PE=2 SV=1
3	AFDB:Q4VB01	0.093	0.113	7.201E-21	235	0.648	0.830	Q4VB01.pdb.gz	Q4VB01_HUMAN HOXB1 protein OS=Homo sapiens OX=9606 GN=HOXB1 PE=1 SV=1
4	AFDB:P49639	0.336	0.304	3.826E-16	335	0.465	0.418	P49639.pdb.gz	HXA1_HUMAN Homeobox protein Hox-A1 OS=Homo sapiens OX=9606 GN=HOXA1 PE=1 SV=2
5	AFDB:A3KNJ6	0.275	0.269	1.989E-15	307	0.419	0.410	A3KNJ6.pdb.gz	A3KNJ6_DANRE Homeo box B1b OS=Danio rerio OX=7955 GN=cb249 PE=2 SV=1
6	AFDB:Q08820	0.289	0.290	2.971E-14	300	0.399	0.400	Q08820.pdb.gz	HXD1_XENLA Homeobox protein Hox-D1 OS=Xenopus laevis OX=8355 GN=hoxd1 PE=2 SV=3
7	AFDB:Q00056	0.216	0.204	1.686E-9	320	0.302	0.284	Q00056.pdb.gz	HXA4_HUMAN Homeobox protein Hox-A4 OS=Homo sapiens OX=9606 GN=HOXA4 PE=2 SV=3
8	AFDB:P18111	0.263	0.292	2.675E-9	268	0.243	0.272	P18111.pdb.gz	CDX1_MOUSE Homeobox protein CDX-1 OS=Mus musculus OX=10090 GN=Cdx1 PE=1 SV=2
9	AFDB:A5PLE8	0.237	0.277	3.260E-9	255	0.216	0.255	A5PLE8.pdb.gz	A5PLE8_DANRE Caudal type homeobox 1 b OS=Danio rerio OX=7955 GN=zgc:165581 PE=2 SV=1
10	AFDB:P47902	0.237	0.266	3.973E-9	265	0.239	0.272	P47902.pdb.gz	CDX1_HUMAN Homeobox protein CDX-1 OS=Homo sapiens OX=9606 GN=CDX1 PE=1 SV=2
11	PDB:4egcA	0.165	0.092	9.076E-3	539	0.053	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.161	0.581	5.041E-2	73	0.070	0.288	2hi3A.pdb.gz
13	PDB:5mrca	0.133	0.208	2.013E-1	177	0.047	0.079	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
14	PDB:7w59R	0.085	0.090	4.744E-1	280	0.076	0.082	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
15	PDB:5nr5A	0.117	0.277	6.176E-1	113	0.037	0.097	5nr5A.pdb.gz
16	PDB:7fbyA	0.128	0.231	7.047E-1	153	0.030	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
17	PDB:5aj0BZ	0.138	0.410	1.276	86	0.033	0.116	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
18	PDB:5gadi	0.157	0.108	1.363	450	0.056	0.038	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
19	PDB:6n7pA	0.063	0.097	1.555	186	0.043	0.070	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
20	PDB:1yioA	0.113	0.164	1.895	198	0.037	0.056	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P14653	0.0	608	301	1.000	1.000	HXB1_HUMAN Homeobox protein Hox-B1 OS=Homo sapiens OX=9606 GN=HOXB1 PE=1 SV=2
2	P17919	9.85e-177	491	297	0.857	0.869	HXB1_MOUSE Homeobox protein Hox-B1 OS=Mus musculus OX=10090 GN=Hoxb1 PE=2 SV=1
3	Q4VB01	1.38e-112	327	235	0.635	0.813	Q4VB01_HUMAN HOXB1 protein OS=Homo sapiens OX=9606 GN=HOXB1 PE=1 SV=1
4	O42366	9.36e-71	223	311	0.505	0.489	HXB1A_DANRE Homeobox protein Hox-B1a OS=Danio rerio OX=7955 GN=hoxb1a PE=2 SV=2
5	P49639	6.58e-60	196	335	0.452	0.406	HXA1_HUMAN Homeobox protein Hox-A1 OS=Homo sapiens OX=9606 GN=HOXA1 PE=1 SV=2
6	A3KNJ6	9.44e-60	194	307	0.425	0.417	A3KNJ6_DANRE Homeo box B1b OS=Danio rerio OX=7955 GN=cb249 PE=2 SV=1
7	Q90423	9.44e-60	194	307	0.425	0.417	HXB1B_DANRE Homeobox protein Hox-B1b OS=Danio rerio OX=7955 GN=hoxb1b PE=2 SV=3
8	P09022	2.64e-57	189	331	0.432	0.393	HXA1_MOUSE Homeobox protein Hox-A1 OS=Mus musculus OX=10090 GN=Hoxa1 PE=1 SV=2
9	Q08820	1.87e-45	157	300	0.402	0.403	HXD1_XENLA Homeobox protein Hox-D1 OS=Xenopus laevis OX=8355 GN=hoxd1 PE=2 SV=3
10	Q01822	2.38e-42	150	328	0.243	0.223	HXD1_MOUSE Homeobox protein Hox-D1 OS=Mus musculus OX=10090 GN=Hoxd1 PE=2 SV=2
11	Q9GZZ0	1.50e-41	148	328	0.339	0.311	HXD1_HUMAN Homeobox protein Hox-D1 OS=Homo sapiens OX=9606 GN=HOXD1 PE=2 SV=1
12	P10105	1.78e-29	119	635	0.169	0.080	LAB_DROME Homeotic protein labial OS=Drosophila melanogaster OX=7227 GN=lab PE=1 SV=2
13	P14652	1.75e-23	100	356	0.189	0.160	HXB2_HUMAN Homeobox protein Hox-B2 OS=Homo sapiens OX=9606 GN=HOXB2 PE=1 SV=1
14	P31264	2.89e-23	102	782	0.163	0.063	HMPB_DROME Homeotic protein proboscipedia OS=Drosophila melanogaster OX=7227 GN=pb PE=2 SV=2
15	P02831	3.66e-23	100	443	0.173	0.117	HXA3_MOUSE Homeobox protein Hox-A3 OS=Mus musculus OX=10090 GN=Hoxa3 PE=1 SV=2
16	O43365	4.20e-23	100	443	0.173	0.117	HXA3_HUMAN Homeobox protein Hox-A3 OS=Homo sapiens OX=9606 GN=HOXA3 PE=1 SV=1
17	Q8AWZ2	1.08e-22	99.0	410	0.173	0.127	HXA3A_DANRE Homeobox protein Hox-A3a OS=Danio rerio OX=7955 GN=hoxa3a PE=2 SV=1
18	P31249	9.52e-22	96.7	432	0.166	0.116	HXD3_HUMAN Homeobox protein Hox-D3 OS=Homo sapiens OX=9606 GN=HOXD3 PE=1 SV=3
19	P17488	1.04e-21	92.4	202	0.209	0.312	HM13_CAEEL Homeobox protein ceh-13 OS=Caenorhabditis elegans OX=6239 GN=ceh-13 PE=4 SV=2
20	P02830	1.47e-21	92.8	229	0.133	0.175	HXA7_MOUSE Homeobox protein Hox-A7 OS=Mus musculus OX=10090 GN=Hoxa7 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	6.2e+02	11.7	Homeobox KN domain
2	PF00046 Homeodomain	1.1e-18	78.1	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405890	0.999	Pre-B-cell leukemia transcription factor 1
2	9606.ENSP00000291547	0.940	Homeobox protein PKNOX1
3	9606.ENSP00000263253	0.929	Histone acetyltransferase p300
4	9606.ENSP00000254066	0.925	Retinoic acid receptor alpha
5	9606.ENSP00000388510	0.925	Retinoic acid receptor gamma
6	9606.ENSP00000419692	0.917	Retinoic acid receptor RXR-alpha
7	9606.ENSP00000361066	0.905	Nuclear receptor coactivator 3
8	9606.ENSP00000362410	0.874	Transcription factor MafB
9	9606.ENSP00000298282	0.848	Homeobox protein PKNOX2
10	9606.ENSP00000328598	0.842	Homeobox protein Hox-D1
11	9606.ENSP00000367203	0.828	Lysine-specific demethylase 6A
12	9606.ENSP00000343246	0.825	Homeobox protein Hox-A1
13	9606.ENSP00000272369	0.817	Homeobox protein Meis1
14	9606.ENSP00000301067	0.812	Histone-lysine N-methyltransferase 2D
15	9606.ENSP00000254846	0.742	Lysine-specific demethylase 6B
16	9606.ENSP00000224356	0.711	Cytochrome P450 26A1
17	9606.ENSP00000242480	0.710	E3 SUMO-protein ligase EGR2
18	9606.ENSP00000340896	0.697	Set1/Ash2 histone methyltransferase complex subunit ASH2
19	9606.ENSP00000264515	0.644	Retinoblastoma-binding protein 5
20	9606.ENSP00000358151	0.638	Histone H2B type 2-E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0019904	0.885	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0010468	0.980	regulation of gene expression
GO:0032501	0.976	multicellular organismal process
GO:0048856	0.976	anatomical structure development
GO:0031326	0.950	regulation of cellular biosynthetic process
GO:0010556	0.949	regulation of macromolecule biosynthetic process
GO:0007275	0.948	multicellular organism development
GO:0051252	0.948	regulation of RNA metabolic process
GO:0006355	0.943	regulation of DNA-templated transcription
GO:0048522	0.928	positive regulation of cellular process
GO:0010604	0.920	positive regulation of macromolecule metabolic process
GO:0051254	0.907	positive regulation of RNA metabolic process
GO:0045893	0.904	positive regulation of DNA-templated transcription
GO:0006357	0.881	regulation of transcription by RNA polymerase II
GO:0009987	0.770	cellular process
GO:0045944	0.700	positive regulation of transcription by RNA polymerase II
GO:0048731	0.543	system development
GO:0048513	0.485	animal organ development
GO:0007389	0.469	pattern specification process
GO:0050896	0.342	response to stimulus
GO:0009653	0.313	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.963	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]