StarFunc result for job id P14672

User Input

>input (509 residues)
MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW
LGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV
LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
VIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPA
RKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL
SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM
CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQIS
AAFHRTPSLLEQEVKPSTELEYLGPDEND

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14142	0.965	0.965	1.376E-62	509	0.953	0.953	P14142.pdb.gz	GLUT4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus OX=10090 GN=Slc2a4 PE=1 SV=3
2	PDB:7wsmA	0.804	0.875	1.230E-48	464	0.912	1.000	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
3	AFDB:P11166	0.924	0.956	2.434E-48	492	0.639	0.661	P11166.pdb.gz	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
4	AFDB:P46896	0.909	0.944	2.528E-47	490	0.625	0.649	P46896.pdb.gz	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
5	AFDB:F1R0Q1	0.903	0.940	3.491E-47	489	0.599	0.624	F1R0Q1.pdb.gz	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
6	AFDB:Q285P3	0.908	0.947	7.516E-47	488	0.572	0.596	Q285P3.pdb.gz	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
7	AFDB:Q9DFV2	0.844	0.854	1.826E-46	503	0.694	0.702	Q9DFV2.pdb.gz	Q9DFV2_SALTR Muscle glucose transporter OS=Salmo trutta OX=8032 PE=2 SV=1
8	AFDB:A0A286Y8I9	0.908	0.841	1.821E-45	550	0.568	0.525	A0A286Y8I9.pdb.gz
9	AFDB:Q8TDB8	0.911	0.892	2.051E-44	520	0.554	0.542	Q8TDB8.pdb.gz	GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens OX=9606 GN=SLC2A14 PE=2 SV=1
10	AFDB:Q90592	0.885	0.846	1.211E-43	533	0.572	0.546	Q90592.pdb.gz	GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus OX=9031 GN=SLC2A2 PE=2 SV=1
11	AFDB:P32037	0.903	0.932	1.481E-43	493	0.544	0.562	P32037.pdb.gz	GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus OX=10090 GN=Slc2a3 PE=1 SV=1
12	PDB:7sptA	0.889	0.962	5.615E-42	470	0.556	0.602	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
13	PDB:6thaA	0.780	0.877	2.589E-39	448	0.607	0.690	6thaA.pdb.gz
14	PDB:4ybqB	0.839	0.922	3.496E-30	462	0.385	0.424	4ybqB.pdb.gz
15	PDB:4gbyA	0.784	0.837	2.023E-21	475	0.257	0.276	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
16	PDB:7aaqA	0.790	0.824	2.176E-18	487	0.238	0.248	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
17	PDB:4ja4A	0.645	0.729	1.633E-16	442	0.246	0.283	4ja4A.pdb.gz
18	PDB:7zh0A	0.636	0.652	3.462E-10	495	0.185	0.190	7zh0A.pdb.gz
19	PDB:3o7qA	0.520	0.618	6.858E-9	414	0.165	0.203	3o7qA.pdb.gz
20	PDB:7bc7A	0.593	0.687	2.123E-8	432	0.128	0.150	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060VUB5	623	480	0.609	0.646	A0A060VUB5_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00081471001 PE=3 SV=1
2	A0A060WJ53	578	477	0.576	0.614	A0A060WJ53_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006116001 PE=4 SV=1
3	F1NTJ1	584	496	0.578	0.593	F1NTJ1_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A14 PE=3 SV=2
4	F1R0Q1	625	489	0.603	0.628	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
5	P11166	650	492	0.635	0.657	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
6	P11167	652	492	0.639	0.661	GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus OX=10116 GN=Slc2a1 PE=1 SV=1
7	P11168	536	524	0.534	0.519	GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens OX=9606 GN=SLC2A2 PE=1 SV=1
8	P11169	567	496	0.558	0.573	GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens OX=9606 GN=SLC2A3 PE=1 SV=1
9	P14142	922	509	0.953	0.953	GLUT4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus OX=10090 GN=Slc2a4 PE=1 SV=3
10	P14672	1005	509	1.000	1.000	GLUT4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens OX=9606 GN=SLC2A4 PE=1 SV=1
11	P17809	651	492	0.637	0.659	GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus OX=10090 GN=Slc2a1 PE=1 SV=4
12	P19357	914	509	0.953	0.953	GLUT4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus OX=10116 GN=Slc2a4 PE=1 SV=1
13	P27674	655	492	0.637	0.659	GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus OX=9913 GN=SLC2A1 PE=1 SV=1
14	P28568	584	496	0.578	0.593	GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A3 PE=2 SV=1
15	P32037	533	493	0.544	0.562	GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus OX=10090 GN=Slc2a3 PE=1 SV=1
16	P46896	638	490	0.629	0.653	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
17	Q07647	552	493	0.550	0.568	GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus OX=10116 GN=Slc2a3 PE=1 SV=1
18	Q102R8	558	504	0.566	0.571	Q102R8_DANRE Glucose transporter 2 OS=Danio rerio OX=7955 GN=glut2 PE=1 SV=1
19	Q285P3	609	488	0.580	0.605	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
20	Q6DFZ5	556	541	0.558	0.525	Q6DFZ5_DANRE Solute carrier family 2 member 3a OS=Danio rerio OX=7955 GN=zgc:92476 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	1.7e-13	61.9	Major Facilitator Superfamily
2	PF16080 Phage_holin_2_3	35	15.6	Bacteriophage holin family HP1
3	PF00083 Sugar_tr	6.3e-149	508.3	Sugar (and other) transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320935

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366863	0.994	TBC1 domain family member 4
2	9606.ENSP00000231368	0.982	Leucyl-cystinyl aminopeptidase
3	9606.ENSP00000287820	0.982	Peroxisome proliferator-activated receptor gamma
4	9606.ENSP00000317714	0.980	Syntaxin-4
5	9606.ENSP00000158762	0.979	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1
6	9606.ENSP00000314214	0.975	Vesicle-associated membrane protein 2
7	9606.ENSP00000427514	0.967	CCAAT/enhancer-binding protein alpha
8	9606.ENSP00000359025	0.962	Syntaxin-binding protein 3
9	9606.ENSP00000367830	0.961	Protein kinase C zeta type
10	9606.ENSP00000238738	0.959	Rho-related GTP-binding protein RhoQ
11	9606.ENSP00000249647	0.958	Synaptosomal-associated protein 23
12	9606.ENSP00000479618	0.956	Myc proto-oncogene protein
13	9606.ENSP00000264710	0.948	Ras-related protein Rab-10
14	9606.ENSP00000365530	0.944	Syntaxin-binding protein 4
15	9606.ENSP00000295797	0.937	Protein kinase C iota type
16	9606.ENSP00000298316	0.935	ADP-ribosylation factor 6
17	9606.ENSP00000320117	0.934	Cdc42-interacting protein 4
18	9606.ENSP00000479606	0.931	Clathrin heavy chain 1
19	9606.ENSP00000419692	0.926	Retinoic acid receptor RXR-alpha
20	9606.ENSP00000362946	0.923	Ras-related protein Rab-14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005355	1.000	glucose transmembrane transporter activity
GO:0005515	0.998	protein binding
GO:0055056	0.678	D-glucose transmembrane transporter activity
GO:0022804	0.434	active transmembrane transporter activity
GO:0015291	0.383	secondary active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0008643	0.998	carbohydrate transport
GO:1904659	0.993	glucose transmembrane transport
GO:0050896	0.720	response to stimulus
GO:0065007	0.642	biological regulation
GO:0050789	0.488	regulation of biological process
GO:0008152	0.460	metabolic process
GO:0050794	0.438	regulation of cellular process
GO:0051716	0.425	cellular response to stimulus
GO:0071704	0.381	organic substance metabolic process
GO:0042221	0.348	response to chemical
GO:0044238	0.309	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.998	endomembrane system
GO:0043227	0.998	membrane-bounded organelle
GO:0031982	0.989	vesicle
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005737	0.974	cytoplasm
GO:0005829	0.953	cytosol
GO:0031410	0.871	cytoplasmic vesicle
GO:0031090	0.496	organelle membrane
GO:0065010	0.348	extracellular membrane-bounded organelle
GO:1903561	0.344	extracellular vesicle
GO:0098588	0.301	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]