StarFunc result for job id P14778

User Input

>input (569 residues)
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKD
DSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL
CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR
LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFK
IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV
QRRSPSSKHQLLSPATKEKLQREAHVPLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14778	1.000	1.000	0.000	569	1.000	1.000	P14778.pdb.gz	IL1R1_HUMAN Interleukin-1 receptor type 1 OS=Homo sapiens OX=9606 GN=IL1R1 PE=1 SV=1
2	AFDB:Q02955	0.776	0.767	4.138E-90	576	0.675	0.667	Q02955.pdb.gz	IL1R1_RAT Interleukin-1 receptor type 1 OS=Rattus norvegicus OX=10116 GN=Il1r1 PE=2 SV=1
3	AFDB:P13504	0.863	0.853	7.835E-90	576	0.692	0.684	P13504.pdb.gz	IL1R1_MOUSE Interleukin-1 receptor type 1 OS=Mus musculus OX=10090 GN=Il1r1 PE=1 SV=1
4	AFDB:Q90874	0.768	0.785	3.972E-65	555	0.402	0.413	Q90874.pdb.gz	Q90874_CHICK IL-1 receptor I OS=Gallus gallus OX=9031 GN=IL-1 receptor I PE=2 SV=1
5	AFDB:Q9HB29	0.480	0.475	1.268E-61	575	0.399	0.395	Q9HB29.pdb.gz	ILRL2_HUMAN Interleukin-1 receptor-like 2 OS=Homo sapiens OX=9606 GN=IL1RL2 PE=1 SV=2
6	AFDB:Q9ERS7	0.459	0.456	4.290E-61	574	0.387	0.383	Q9ERS7.pdb.gz	ILRL2_MOUSE Interleukin-1 receptor-like 2 OS=Mus musculus OX=10090 GN=Il1rl2 PE=1 SV=1
7	AFDB:P14719	0.466	0.467	1.128E-52	567	0.267	0.268	P14719.pdb.gz	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2
8	AFDB:Q01638	0.358	0.366	3.085E-51	556	0.274	0.281	Q01638.pdb.gz	ILRL1_HUMAN Interleukin-1 receptor-like 1 OS=Homo sapiens OX=9606 GN=IL1RL1 PE=1 SV=4
9	AFDB:Q62611	0.554	0.556	1.479E-50	566	0.271	0.272	Q62611.pdb.gz	ILRL1_RAT Interleukin-1 receptor-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rl1 PE=2 SV=1
10	AFDB:Q8QFN4	0.535	0.534	3.967E-50	571	0.258	0.257	Q8QFN4.pdb.gz	Q8QFN4_SALSA Interleukin-1 receptor type I OS=Salmo salar OX=8030 GN=IL-1RL PE=2 SV=1
11	PDB:6dldD	0.149	0.268	2.516E-12	269	0.081	0.171	6dldD.pdb.gz
12	PDB:3o3uN	0.212	0.209	1.206E-11	580	0.060	0.059	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
13	PDB:5oj2B	0.173	0.149	1.521E-11	692	0.088	0.072	5oj2B.pdb.gz
14	PDB:1e07A	0.191	0.174	5.781E-11	642	0.084	0.075	1e07A.pdb.gz
15	PDB:6dlfA	0.133	0.302	2.113E-9	236	0.076	0.182	6dlfA.pdb.gz
16	PDB:2rcjC	0.148	0.157	1.435E-8	523	0.072	0.078	2rcjC.pdb.gz
17	PDB:2qhrL	0.165	0.350	2.718E-8	218	0.058	0.151	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
18	PDB:1q0xL	0.166	0.370	3.235E-8	212	0.042	0.113	1q0xL.pdb.gz
19	PDB:3c2aL	0.156	0.360	3.235E-8	216	0.046	0.120	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
20	PDB:4r2gP	0.152	0.358	4.324E-8	210	0.049	0.133	4r2gP.pdb.gz	Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13504	0.0	828	576	0.692	0.684	IL1R1_MOUSE Interleukin-1 receptor type 1 OS=Mus musculus OX=10090 GN=Il1r1 PE=1 SV=1
2	P14778	0.0	1181	569	1.000	1.000	IL1R1_HUMAN Interleukin-1 receptor type 1 OS=Homo sapiens OX=9606 GN=IL1R1 PE=1 SV=1
3	Q02955	0.0	816	576	0.680	0.672	IL1R1_RAT Interleukin-1 receptor type 1 OS=Rattus norvegicus OX=10116 GN=Il1r1 PE=2 SV=1
4	Q90874	1.10e-148	441	555	0.392	0.402	Q90874_CHICK IL-1 receptor I OS=Gallus gallus OX=9031 GN=IL-1 receptor I PE=2 SV=1
5	Q9ERS7	9.18e-130	393	574	0.408	0.404	ILRL2_MOUSE Interleukin-1 receptor-like 2 OS=Mus musculus OX=10090 GN=Il1rl2 PE=1 SV=1
6	Q9HB29	1.03e-121	372	575	0.417	0.412	ILRL2_HUMAN Interleukin-1 receptor-like 2 OS=Homo sapiens OX=9606 GN=IL1RL2 PE=1 SV=2
7	Q62611	2.37e-66	228	566	0.278	0.279	ILRL1_RAT Interleukin-1 receptor-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rl1 PE=2 SV=1
8	P14719	2.57e-66	227	567	0.272	0.273	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2
9	Q01638	2.89e-65	224	556	0.278	0.284	ILRL1_HUMAN Interleukin-1 receptor-like 1 OS=Homo sapiens OX=9606 GN=IL1RL1 PE=1 SV=4
10	Q8QFN4	5.01e-62	216	571	0.279	0.278	Q8QFN4_SALSA Interleukin-1 receptor type I OS=Salmo salar OX=8030 GN=IL-1RL PE=2 SV=1
11	B6ZK77	3.30e-59	211	700	0.269	0.219	IRL1B_DANRE Interleukin-1 receptor accessory protein-like 1-B OS=Danio rerio OX=7955 GN=il1rapl1b PE=1 SV=1
12	Q9NP60	8.32e-55	199	686	0.276	0.229	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
13	Q13478	5.70e-51	185	541	0.274	0.288	IL18R_HUMAN Interleukin-18 receptor 1 OS=Homo sapiens OX=9606 GN=IL18R1 PE=1 SV=1
14	P59824	4.73e-50	186	696	0.271	0.221	IRPL1_RAT Interleukin-1 receptor accessory protein-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rapl1 PE=2 SV=1
15	Q61098	9.09e-50	182	537	0.258	0.274	IL18R_MOUSE Interleukin-18 receptor 1 OS=Mus musculus OX=10090 GN=Il18r1 PE=1 SV=1
16	Q9NZN1	5.88e-49	182	696	0.269	0.220	IRPL1_HUMAN Interleukin-1 receptor accessory protein-like 1 OS=Homo sapiens OX=9606 GN=IL1RAPL1 PE=1 SV=2
17	P59823	1.29e-48	181	695	0.269	0.220	IRPL1_MOUSE Interleukin-1 receptor accessory protein-like 1 OS=Mus musculus OX=10090 GN=Il1rapl1 PE=1 SV=1
18	B6ZK78	5.83e-45	171	681	0.257	0.214	B6ZK78_DANRE Interleukin 1-receptor accessory protein-like 2 OS=Danio rerio OX=7955 GN=si:ch211-149o12.1 PE=2 SV=1
19	Q70YG5	2.49e-38	150	568	0.232	0.232	Q70YG5_SALSA Interleukin 1 receptor accessory protein OS=Salmo salar OX=8030 GN=il-1racp PE=2 SV=1
20	M1ZJW4	1.82e-37	148	599	0.258	0.245	M1ZJW4_ONCMY Interleukin 1 receptor-like 1 (ST2L) OS=Oncorhynchus mykiss OX=8022 GN=IL1RL1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	1.7e+02	13.4	Adenovirus E3 region protein CR1
2	PF07679 I-set	4.3e-14	63.7	Immunoglobulin I-set domain
3	PF00047 ig	4.2e-08	44.6	Immunoglobulin domain
4	PF13895 Ig_2	1.7e-16	71.6	Immunoglobulin domain
5	PF13927 Ig_3	5.9e-19	79.7	Immunoglobulin domain
6	PF16680 Ig_4	6.2e+02	12.4	T-cell surface glycoprotein CD3 delta chain
7	PF16681 Ig_5	1.7	20.5	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
8	PF18452 Ig_6	0.00088	30.5	Immunoglobulin domain
9	PF01582 TIR	2.1e-29	114.1	TIR domain
10	PF13676 TIR_2	26	16.9	TIR domain
11	PF07686 V-set	11	17.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386380

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259206	0.999	Interleukin-1 receptor antagonist protein
2	9606.ENSP00000263339	0.999	Interleukin-1 alpha
3	9606.ENSP00000263341	0.999	Interleukin-1 beta
4	9606.ENSP00000401399	0.999	Myeloid differentiation primary response protein MyD88
5	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
6	9606.ENSP00000314807	0.998	Interleukin 1 receptor accessory protein
7	9606.ENSP00000358997	0.998	Interleukin-1 receptor-associated kinase 1
8	9606.ENSP00000314733	0.993	Toll-interacting protein
9	9606.ENSP00000256458	0.988	Interleukin-1 receptor-associated kinase-like 2
10	9606.ENSP00000390651	0.987	Interleukin-1 receptor-associated kinase 4
11	9606.ENSP00000428056	0.977	Phosphatidylinositol 3-kinase regulatory subunit alpha
12	9606.ENSP00000412237	0.967	Interleukin-10
13	9606.ENSP00000261233	0.960	Interleukin-1 receptor-associated kinase 3
14	9606.ENSP00000216160	0.954	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
15	9606.ENSP00000458770	0.954	Acyl carrier protein, mitochondrial
16	9606.ENSP00000415139	0.952	TIR domain-containing adapter molecule 2
17	9606.ENSP00000359424	0.951	Inhibitor of nuclear factor kappa-B kinase subunit alpha
18	9606.ENSP00000264832	0.947	Intercellular adhesion molecule 1
19	9606.ENSP00000280357	0.947	Interleukin-18
20	9606.ENSP00000327513	0.947	Macrophage colony-stimulating factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004896	1.000	cytokine receptor activity
GO:0070851	0.998	growth factor receptor binding
GO:0004908	0.501	interleukin-1 receptor activity
GO:0019899	0.320	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0048518	0.988	positive regulation of biological process
GO:0048583	0.986	regulation of response to stimulus
GO:0050794	0.985	regulation of cellular process
GO:0048584	0.981	positive regulation of response to stimulus
GO:0002684	0.981	positive regulation of immune system process
GO:0071345	0.979	cellular response to cytokine stimulus
GO:0007166	0.967	cell surface receptor signaling pathway
GO:0019221	0.938	cytokine-mediated signaling pathway
GO:0001819	0.928	positive regulation of cytokine production
GO:0002376	0.911	immune system process
GO:0050778	0.885	positive regulation of immune response
GO:0048522	0.877	positive regulation of cellular process
GO:0070555	0.864	response to interleukin-1
GO:0002697	0.739	regulation of immune effector process
GO:0006950	0.713	response to stress
GO:0002819	0.707	regulation of adaptive immune response
GO:0002699	0.688	positive regulation of immune effector process
GO:0002703	0.682	regulation of leukocyte mediated immunity
GO:0002706	0.659	regulation of lymphocyte mediated immunity
GO:0002822	0.640	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002705	0.618	positive regulation of leukocyte mediated immunity
GO:0002708	0.579	positive regulation of lymphocyte mediated immunity
GO:0002711	0.547	positive regulation of T cell mediated immunity
GO:0031323	0.538	regulation of cellular metabolic process
GO:0009605	0.501	response to external stimulus
GO:0006955	0.498	immune response
GO:0051171	0.493	regulation of nitrogen compound metabolic process
GO:0032649	0.493	regulation of type II interferon production
GO:0071347	0.455	cellular response to interleukin-1
GO:0032101	0.442	regulation of response to external stimulus
GO:0009966	0.436	regulation of signal transduction
GO:0031347	0.422	regulation of defense response
GO:0006952	0.405	defense response
GO:0002700	0.390	regulation of production of molecular mediator of immune response
GO:0080090	0.332	regulation of primary metabolic process
GO:0048519	0.326	negative regulation of biological process
GO:0009889	0.326	regulation of biosynthetic process
GO:0065009	0.324	regulation of molecular function
GO:0009967	0.322	positive regulation of signal transduction
GO:0031326	0.321	regulation of cellular biosynthetic process
GO:0032103	0.302	positive regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.847	intracellular anatomical structure
GO:0043227	0.752	membrane-bounded organelle
GO:0005737	0.467	cytoplasm
GO:0005615	0.352	extracellular space
GO:0043231	0.300	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]