StarFunc result for job id P14780

User Input

>input (707 residues)
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14780	1.000	1.000	0.000	707	1.000	1.000	P14780.pdb.gz	MMP9_HUMAN Matrix metalloproteinase-9 OS=Homo sapiens OX=9606 GN=MMP9 PE=1 SV=3
2	AFDB:P41245	0.593	0.575	0.000	730	0.744	0.721	P41245.pdb.gz	MMP9_MOUSE Matrix metalloproteinase-9 OS=Mus musculus OX=10090 GN=Mmp9 PE=1 SV=2
3	AFDB:P50282	0.626	0.625	0.000	708	0.743	0.742	P50282.pdb.gz	MMP9_RAT Matrix metalloproteinase-9 OS=Rattus norvegicus OX=10116 GN=Mmp9 PE=2 SV=1
4	AFDB:F1QC76	0.577	0.599	1.913E-102	680	0.571	0.594	F1QC76.pdb.gz
5	AFDB:B5X4C7	0.572	0.602	6.299E-98	671	0.557	0.587	B5X4C7.pdb.gz	B5X4C7_SALSA Matrix metalloproteinase-9 OS=Salmo salar OX=8030 GN=MMP9 PE=2 SV=1
6	AFDB:Q90611	0.560	0.595	1.885E-81	663	0.453	0.483	Q90611.pdb.gz	MMP2_CHICK 72 kDa type IV collagenase OS=Gallus gallus OX=9031 GN=MMP2 PE=1 SV=1
7	AFDB:P33434	0.559	0.595	2.632E-81	662	0.453	0.483	P33434.pdb.gz	MMP2_MOUSE 72 kDa type IV collagenase OS=Mus musculus OX=10090 GN=Mmp2 PE=1 SV=1
8	AFDB:Q6DG10	0.556	0.596	8.006E-81	657	0.447	0.481	Q6DG10.pdb.gz
9	PDB:1gxdA	0.528	0.594	8.312E-70	624	0.434	0.492	1gxdA.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
10	AFDB:O55123	0.381	0.541	7.266E-41	476	0.259	0.384	O55123.pdb.gz	MMP10_MOUSE Stromelysin-2 OS=Mus musculus OX=10090 GN=Mmp10 PE=2 SV=1
11	AFDB:P45452	0.309	0.460	1.497E-40	471	0.267	0.401	P45452.pdb.gz	MMP13_HUMAN Collagenase 3 OS=Homo sapiens OX=9606 GN=MMP13 PE=1 SV=1
12	PDB:1su3B	0.289	0.488	4.565E-35	416	0.222	0.377	1su3B.pdb.gz	X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding.
13	PDB:2mzeA	0.292	0.779	7.420E-14	250	0.143	0.404	2mzeA.pdb.gz	Charge-Triggered Membrane Insertion of Matrix Metalloproteinase-7, Supporter of Innate Immunity and Tumors.
14	PDB:3lp9A	0.235	0.668	1.212E-10	227	0.062	0.194	3lp9A.pdb.gz	Crystal structure and functional insights of hemopexin fold protein from grass pea
15	PDB:1h8pA	0.063	0.478	3.338E-8	88	0.050	0.398	1h8pA.pdb.gz	Sperm Coating Mechanism from the 1.8 A Crystal Structure of Pdc-109-Phosphorylcholine Complex
16	PDB:1nr0A	0.152	0.173	7.780E-6	610	0.041	0.048	1nr0A.pdb.gz
17	PDB:6nd4N	0.156	0.161	2.502E-5	678	0.033	0.034	6nd4N.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
18	PDB:2vduD	0.156	0.261	5.452E-5	376	0.033	0.061	2vduD.pdb.gz
19	PDB:7fikF	0.147	0.280	6.442E-5	326	0.024	0.052	7fikF.pdb.gz
20	PDB:5lcwR	0.159	0.265	6.810E-5	383	0.033	0.060	5lcwR.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5X4C7	0.0	817	671	0.562	0.592	B5X4C7_SALSA Matrix metalloproteinase-9 OS=Salmo salar OX=8030 GN=MMP9 PE=2 SV=1
2	P08253	0.0	599	660	0.453	0.485	MMP2_HUMAN 72 kDa type IV collagenase OS=Homo sapiens OX=9606 GN=MMP2 PE=1 SV=2
3	P14780	0.0	1453	707	1.000	1.000	MMP9_HUMAN Matrix metalloproteinase-9 OS=Homo sapiens OX=9606 GN=MMP9 PE=1 SV=3
4	P33434	0.0	595	662	0.457	0.488	MMP2_MOUSE 72 kDa type IV collagenase OS=Mus musculus OX=10090 GN=Mmp2 PE=1 SV=1
5	P33436	0.0	596	662	0.461	0.492	MMP2_RAT 72 kDa type IV collagenase OS=Rattus norvegicus OX=10116 GN=Mmp2 PE=1 SV=2
6	P41245	0.0	1086	730	0.747	0.723	MMP9_MOUSE Matrix metalloproteinase-9 OS=Mus musculus OX=10090 GN=Mmp9 PE=1 SV=2
7	P50282	0.0	1063	708	0.740	0.739	MMP9_RAT Matrix metalloproteinase-9 OS=Rattus norvegicus OX=10116 GN=Mmp9 PE=2 SV=1
8	Q7SZM5	0.0	593	657	0.446	0.479	Q7SZM5_DANRE 72 kDa type IV collagenase precursor OS=Danio rerio OX=7955 GN=wu:fk89d01 PE=2 SV=1
9	Q7T317	0.0	832	680	0.571	0.594	Q7T317_DANRE Matrix metalloproteinase 9 OS=Danio rerio OX=7955 GN=wu:fi98c09 PE=2 SV=1
10	Q90611	0.0	594	663	0.457	0.487	MMP2_CHICK 72 kDa type IV collagenase OS=Gallus gallus OX=9031 GN=MMP2 PE=1 SV=1
11	P08254	1.88e-49	182	477	0.137	0.203	MMP3_HUMAN Stromelysin-1 OS=Homo sapiens OX=9606 GN=MMP3 PE=1 SV=2
12	O55123	1.10e-48	180	476	0.139	0.206	MMP10_MOUSE Stromelysin-2 OS=Mus musculus OX=10090 GN=Mmp10 PE=2 SV=1
13	P09238	2.27e-48	179	476	0.134	0.200	MMP10_HUMAN Stromelysin-2 OS=Homo sapiens OX=9606 GN=MMP10 PE=1 SV=1
14	P45452	7.38e-48	177	471	0.144	0.217	MMP13_HUMAN Collagenase 3 OS=Homo sapiens OX=9606 GN=MMP13 PE=1 SV=1
15	F1QCX8	5.08e-47	175	476	0.126	0.187	F1QCX8_DANRE Matrix metallopeptidase 13a OS=Danio rerio OX=7955 GN=cb1034 PE=3 SV=2
16	P03956	5.99e-46	172	469	0.127	0.192	MMP1_HUMAN Interstitial collagenase OS=Homo sapiens OX=9606 GN=MMP1 PE=1 SV=3
17	P28862	1.07e-45	172	477	0.130	0.193	MMP3_MOUSE Stromelysin-1 OS=Mus musculus OX=10090 GN=Mmp3 PE=2 SV=2
18	P33435	1.37e-45	171	472	0.143	0.214	MMP13_MOUSE Collagenase 3 OS=Mus musculus OX=10090 GN=Mmp13 PE=1 SV=1
19	P23097	1.08e-44	169	466	0.140	0.212	MMP13_RAT Collagenase 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Mmp13 PE=1 SV=1
20	P03957	2.49e-44	168	475	0.119	0.177	MMP3_RAT Stromelysin-1 OS=Rattus norvegicus OX=10116 GN=Mmp3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01400 Astacin	1.1e+02	13.8	Astacin (Peptidase family M12A)
2	PF16313 DUF4953	3.3e+02	11.9	Met-zincin
3	PF00040 fn2	2e-52	186.3	Fibronectin type II domain
4	PF00045 Hemopexin	4.2e-32	121.1	Hemopexin
5	PF00413 Peptidase_M10	1.3e-59	212.0	Matrixin
6	PF10462 Peptidase_M66	6.5e+02	10.7	Peptidase M66
7	PF01471 PG_binding_1	0.022	26.2	Putative peptidoglycan binding domain
8	PF04886 PT	0.16	22.9	PT repeat
9	PF13582 Reprolysin_3	89	15.0	Metallo-peptidase family M12B Reprolysin-like
10	PF13583 Reprolysin_4	1.4e+02	13.5	Metallo-peptidase family M12B Reprolysin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361405

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000218388	0.999	Metalloproteinase inhibitor 1
2	9606.ENSP00000362108	0.999	Neutrophil gelatinase-associated lipocalin
3	9606.ENSP00000398632	0.996	CD44 antigen
4	9606.ENSP00000221930	0.991	Transforming growth factor beta-1
5	9606.ENSP00000266085	0.987	Metalloproteinase inhibitor 3
6	9606.ENSP00000478570	0.987	Vascular endothelial growth factor A
7	9606.ENSP00000385675	0.986	Interleukin-6
8	9606.ENSP00000308938	0.984	Plasminogen
9	9606.ENSP00000370542	0.984	Syndecan-1
10	9606.ENSP00000261769	0.983	Cadherin-1
11	9606.ENSP00000264498	0.974	Fibroblast growth factor 2
12	9606.ENSP00000412237	0.974	Interleukin-10
13	9606.ENSP00000264657	0.973	Signal transducer and activator of transcription 3
14	9606.ENSP00000222390	0.970	Hepatocyte growth factor
15	9606.ENSP00000362680	0.970	Proto-oncogene tyrosine-protein kinase Src
16	9606.ENSP00000441691	0.969	Integrin alpha-M
17	9606.ENSP00000279441	0.966	Stromelysin-2
18	9606.ENSP00000387356	0.965	Aggrecan core protein
19	9606.ENSP00000260356	0.964	Thrombospondin-1
20	9606.ENSP00000344192	0.964	Interleukin-17A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004222	1.000	metalloendopeptidase activity
GO:0005515	0.998	protein binding
GO:0044877	0.894	protein-containing complex binding
GO:0008236	0.837	serine-type peptidase activity
GO:0004252	0.823	serine-type endopeptidase activity
GO:0043167	0.819	ion binding
GO:0046914	0.800	transition metal ion binding
GO:0008270	0.756	zinc ion binding
GO:0005518	0.746	collagen binding
GO:0042802	0.619	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.992	response to stimulus
GO:0048518	0.990	positive regulation of biological process
GO:0050794	0.988	regulation of cellular process
GO:0032501	0.980	multicellular organismal process
GO:0048522	0.979	positive regulation of cellular process
GO:0032502	0.978	developmental process
GO:0051716	0.976	cellular response to stimulus
GO:0019222	0.965	regulation of metabolic process
GO:0048856	0.960	anatomical structure development
GO:0030198	0.953	extracellular matrix organization
GO:0060255	0.952	regulation of macromolecule metabolic process
GO:0051239	0.948	regulation of multicellular organismal process
GO:0048731	0.922	system development
GO:0008152	0.918	metabolic process
GO:0006950	0.914	response to stress
GO:0042221	0.912	response to chemical
GO:0048583	0.904	regulation of response to stimulus
GO:0048523	0.902	negative regulation of cellular process
GO:0071704	0.872	organic substance metabolic process
GO:0044238	0.842	primary metabolic process
GO:0030334	0.827	regulation of cell migration
GO:0080090	0.824	regulation of primary metabolic process
GO:0051171	0.822	regulation of nitrogen compound metabolic process
GO:0010941	0.805	regulation of cell death
GO:0065009	0.803	regulation of molecular function
GO:0010646	0.802	regulation of cell communication
GO:0023051	0.801	regulation of signaling
GO:0006807	0.788	nitrogen compound metabolic process
GO:0032963	0.782	collagen metabolic process
GO:0043170	0.774	macromolecule metabolic process
GO:0016477	0.770	cell migration
GO:0043067	0.763	regulation of programmed cell death
GO:0050790	0.759	regulation of catalytic activity
GO:0009653	0.757	anatomical structure morphogenesis
GO:0042981	0.754	regulation of apoptotic process
GO:0007154	0.753	cell communication
GO:1901564	0.745	organonitrogen compound metabolic process
GO:0019538	0.743	protein metabolic process
GO:0009966	0.738	regulation of signal transduction
GO:0007165	0.737	signal transduction
GO:0030154	0.735	cell differentiation
GO:0009893	0.719	positive regulation of metabolic process
GO:0031323	0.712	regulation of cellular metabolic process
GO:0044092	0.688	negative regulation of molecular function
GO:0009888	0.683	tissue development
GO:0042127	0.664	regulation of cell population proliferation
GO:0044093	0.650	positive regulation of molecular function
GO:0051246	0.612	regulation of protein metabolic process
GO:0070887	0.609	cellular response to chemical stimulus
GO:0048513	0.600	animal organ development
GO:0009628	0.585	response to abiotic stimulus
GO:0010604	0.580	positive regulation of macromolecule metabolic process
GO:0008284	0.573	positive regulation of cell population proliferation
GO:0001501	0.550	skeletal system development
GO:1902531	0.528	regulation of intracellular signal transduction
GO:0040017	0.518	positive regulation of locomotion
GO:1901700	0.512	response to oxygen-containing compound
GO:0051098	0.502	regulation of binding
GO:0009892	0.492	negative regulation of metabolic process
GO:0010468	0.475	regulation of gene expression
GO:0042325	0.474	regulation of phosphorylation
GO:0051173	0.466	positive regulation of nitrogen compound metabolic process
GO:0031399	0.463	regulation of protein modification process
GO:0048584	0.456	positive regulation of response to stimulus
GO:0031325	0.445	positive regulation of cellular metabolic process
GO:0009314	0.422	response to radiation
GO:0007166	0.411	cell surface receptor signaling pathway
GO:2000147	0.395	positive regulation of cell motility
GO:0010033	0.379	response to organic substance
GO:0030335	0.377	positive regulation of cell migration
GO:0104004	0.368	cellular response to environmental stimulus
GO:0048646	0.366	anatomical structure formation involved in morphogenesis
GO:0009416	0.363	response to light stimulus
GO:0009889	0.358	regulation of biosynthetic process
GO:0050793	0.353	regulation of developmental process
GO:0080134	0.353	regulation of response to stress
GO:0031326	0.349	regulation of cellular biosynthetic process
GO:0010605	0.349	negative regulation of macromolecule metabolic process
GO:0009790	0.347	embryo development
GO:0032101	0.346	regulation of response to external stimulus
GO:0022414	0.345	reproductive process
GO:0051247	0.343	positive regulation of protein metabolic process
GO:0009967	0.338	positive regulation of signal transduction
GO:0060548	0.331	negative regulation of cell death
GO:0009605	0.329	response to external stimulus
GO:0019219	0.325	regulation of nucleobase-containing compound metabolic process
GO:0051240	0.316	positive regulation of multicellular organismal process
GO:0044237	0.312	cellular metabolic process
GO:0071214	0.301	cellular response to abiotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.998	cell periphery
GO:0005576	0.998	extracellular region
GO:0043227	0.994	membrane-bounded organelle
GO:0005615	0.983	extracellular space
GO:0030312	0.975	external encapsulating structure
GO:0031012	0.972	extracellular matrix
GO:0043229	0.967	intracellular organelle
GO:0005737	0.965	cytoplasm
GO:0043231	0.944	intracellular membrane-bounded organelle
GO:0031982	0.920	vesicle
GO:0012505	0.898	endomembrane system
GO:0016020	0.857	membrane
GO:0031410	0.761	cytoplasmic vesicle
GO:0070013	0.758	intracellular organelle lumen
GO:0070062	0.729	extracellular exosome
GO:0062023	0.584	collagen-containing extracellular matrix
GO:0031981	0.335	nuclear lumen
GO:0005654	0.307	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.
EC:3.4.21.-	0.823	Serine endopeptidases.

[back to server]