StarFunc result for job id P14859

User Input

>input (743 residues)
MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTS
LQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQ
LLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQ
QLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQSQ
PSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRI
KLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSDS
SLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEK
EVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLVTSSAATTLTVSP
VLPLTSAAVTNLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSA
SETSTTQTTSTPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNP
SLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSLPITSLDATGNLV
FANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASAGNSAPVASLHATSTSAESIQ
NSLFTVASASGAASTTTTASKAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1NSK6	0.281	0.274	1.071E-80	766	0.964	0.935	F1NSK6.pdb.gz
2	AFDB:P25425	0.347	0.337	6.179E-79	770	0.935	0.903	P25425.pdb.gz	PO2F1_MOUSE POU domain, class 2, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou2f1 PE=1 SV=3
3	AFDB:P16143	0.303	0.298	6.746E-73	758	0.864	0.847	P16143.pdb.gz	PO2F1_XENLA POU domain, class 2, transcription factor 1 OS=Xenopus laevis OX=8355 GN=pou2f1 PE=1 SV=3
4	AFDB:H0YKT2	0.223	0.265	3.063E-28	618	0.349	0.419	H0YKT2.pdb.gz	H0YKT2_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=2
5	PDB:6t90K	0.094	0.932	2.861E-7	73	0.063	0.644	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
6	AFDB:P53564	0.119	0.066	6.620E-7	1515	0.167	0.082	P53564.pdb.gz	CUX1_MOUSE Homeobox protein cut-like 1 OS=Mus musculus OX=10090 GN=Cux1 PE=1 SV=3
7	AFDB:Q9UIU6	0.082	0.078	4.886E-4	781	0.160	0.152	Q9UIU6.pdb.gz	SIX4_HUMAN Homeobox protein SIX4 OS=Homo sapiens OX=9606 GN=SIX4 PE=1 SV=2
8	AFDB:P38041	0.062	0.049	1.038E-3	980	0.129	0.098	P38041.pdb.gz	BOB1_YEAST Protein BOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BOI1 PE=1 SV=1
9	AFDB:Q52KP9	0.052	0.056	1.748E-3	679	0.139	0.152	Q52KP9.pdb.gz	Q52KP9_MOUSE Kidins220 protein (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
10	AFDB:X1WE18	0.045	0.035	3.502E-3	1085	0.141	0.097	X1WE18.pdb.gz	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
11	AFDB:Q9VWL7	0.060	0.038	4.679E-3	1317	0.118	0.067	Q9VWL7.pdb.gz	Q9VWL7_DROME Rho GTPase activating protein at 18B, isoform C OS=Drosophila melanogaster OX=7227 GN=RhoGAP18B PE=4 SV=2
12	PDB:4egcA	0.087	0.108	1.085E-2	539	0.044	0.061	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:2hi3A	0.077	0.608	1.388E-1	73	0.023	0.233	2hi3A.pdb.gz
14	PDB:4h63H	0.044	0.141	3.124E-1	174	0.028	0.121	4h63H.pdb.gz
15	PDB:6kopF	0.049	0.193	4.422E-1	159	0.035	0.164	6kopF.pdb.gz	RNA extension drives a stepwise displacement of an initiation-factor structural module in initial transcription.
16	PDB:7fbyA	0.059	0.245	4.965E-1	153	0.015	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
17	PDB:3f51A	0.069	0.440	5.575E-1	94	0.015	0.117	3f51A.pdb.gz
18	PDB:6jcxF	0.051	0.143	5.908E-1	186	0.031	0.124	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
19	PDB:6dv9F	0.050	0.148	7.893E-1	174	0.024	0.103	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
20	PDB:2cg4A	0.060	0.255	8.862E-1	149	0.013	0.067	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DG88	0.0	1063	561	0.740	0.980	A0A0C4DG88_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU2F1 PE=1 SV=1
2	P14859	0.0	1434	743	1.000	1.000	PO2F1_HUMAN POU domain, class 2, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU2F1 PE=1 SV=2
3	P15143	0.0	1355	739	0.961	0.966	PO2F1_CHICK POU domain, class 2, transcription factor 1 OS=Gallus gallus OX=9031 GN=POU2F1 PE=2 SV=1
4	P16143	0.0	1002	758	0.851	0.834	PO2F1_XENLA POU domain, class 2, transcription factor 1 OS=Xenopus laevis OX=8355 GN=pou2f1 PE=1 SV=3
5	P25425	0.0	1020	770	0.929	0.896	PO2F1_MOUSE POU domain, class 2, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou2f1 PE=1 SV=3
6	P31503	0.0	889	632	0.777	0.913	PO2F1_RAT POU domain, class 2, transcription factor 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Pou2f1 PE=1 SV=2
7	Q29076	0.0	1403	745	0.980	0.977	PO2F1_PIG POU domain, class 2, transcription factor 1 OS=Sus scrofa OX=9823 GN=POU2F1 PE=2 SV=1
8	O57602	3.34e-179	528	623	0.462	0.551	O57602_ICTPU POU domain protein OS=Ictalurus punctatus OX=7998 GN=Oct1 PE=2 SV=1
9	A0A0A0MT46	1.93e-157	471	594	0.451	0.564	A0A0A0MT46_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU2F1 PE=1 SV=1
10	B5ME60	4.69e-127	392	586	0.347	0.440	B5ME60_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=4
11	A0A0G2K3R5	2.64e-126	391	606	0.347	0.426	A0A0G2K3R5_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=1 SV=2
12	A0A8I6A150	3.95e-123	384	661	0.363	0.408	A0A8I6A150_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=3 SV=1
13	P09086	2.01e-111	348	479	0.257	0.399	PO2F2_HUMAN POU domain, class 2, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=3
14	A0A8I5ZSA9	5.93e-111	345	440	0.257	0.434	A0A8I5ZSA9_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=3 SV=1
15	H0YNW1	2.49e-110	343	424	0.252	0.441	H0YNW1_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=1
16	A0A8I6A6L7	3.81e-110	345	489	0.257	0.391	A0A8I6A6L7_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=3 SV=1
17	Q00196	4.20e-110	344	463	0.253	0.406	PO2F2_MOUSE POU domain, class 2, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou2f2 PE=2 SV=4
18	H0YLL6	1.28e-109	343	485	0.252	0.386	H0YLL6_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=1
19	A0A0G2KAN4	2.58e-109	345	547	0.252	0.342	A0A0G2KAN4_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=1 SV=2
20	H0YKT2	7.90e-109	346	618	0.252	0.303	H0YKT2_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	78	14.6	Homeobox KN domain
2	PF00046 Homeodomain	2.6e-14	64.1	Homeodomain
3	PF13560 HTH_31	1.2e+02	14.5	Helix-turn-helix domain
4	PF00157 Pou	7.2e-33	123.7	Pou domain - N-terminal to homeobox domain
5	PF19536 POU2F1_C	2.9e-118	406.1	POU domain, class 2, transcription factor 1 C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356840

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323588	0.995	Transcription factor SOX-2
2	9606.ENSP00000376786	0.991	POU domain class 2-associating factor 1
3	9606.ENSP00000309555	0.979	Host cell factor 1
4	9606.ENSP00000418960	0.973	Breast cancer type 1 susceptibility protein
5	9606.ENSP00000329357	0.958	Transcription factor Sp1
6	9606.ENSP00000298532	0.950	snRNA-activating protein complex subunit 4
7	9606.ENSP00000384371	0.948	B-cell lymphoma 6 protein
8	9606.ENSP00000351015	0.937	Neurofibromin
9	9606.ENSP00000229307	0.931	Homeobox protein NANOG
10	9606.ENSP00000354487	0.926	Zinc finger E-box-binding homeobox 1
11	9606.ENSP00000479618	0.924	Myc proto-oncogene protein
12	9606.ENSP00000261523	0.920	Nuclear receptor ROR-alpha
13	9606.ENSP00000264110	0.920	Cyclic AMP-dependent transcription factor ATF-2
14	9606.ENSP00000437955	0.920	Hypoxia-inducible factor 1-alpha
15	9606.ENSP00000264657	0.916	Signal transducer and activator of transcription 3
16	9606.ENSP00000386165	0.916	CCAAT/enhancer-binding protein delta
17	9606.ENSP00000242261	0.915	Twist-related protein 1
18	9606.ENSP00000368880	0.915	Forkhead box protein O1
19	9606.ENSP00000227507	0.910	G1/S-specific cyclin-D1
20	9606.ENSP00000385824	0.909	Forkhead box protein O3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	1.000	sequence-specific DNA binding
GO:0003682	0.955	chromatin binding
GO:1990837	0.929	sequence-specific double-stranded DNA binding
GO:0140110	0.927	transcription regulator activity
GO:0003700	0.917	DNA-binding transcription factor activity
GO:0000976	0.815	transcription cis-regulatory region binding
GO:0008134	0.751	transcription factor binding
GO:0001221	0.680	transcription coregulator binding
GO:0001223	0.661	transcription coactivator binding
GO:0000981	0.477	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.353	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0010468	0.985	regulation of gene expression
GO:0050794	0.982	regulation of cellular process
GO:0048519	0.963	negative regulation of biological process
GO:0006355	0.954	regulation of DNA-templated transcription
GO:0009892	0.935	negative regulation of metabolic process
GO:0010605	0.919	negative regulation of macromolecule metabolic process
GO:0009987	0.842	cellular process
GO:0048518	0.791	positive regulation of biological process
GO:0006357	0.623	regulation of transcription by RNA polymerase II
GO:0048522	0.619	positive regulation of cellular process
GO:0010604	0.617	positive regulation of macromolecule metabolic process
GO:0051173	0.563	positive regulation of nitrogen compound metabolic process
GO:0031325	0.553	positive regulation of cellular metabolic process
GO:0045935	0.518	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.512	positive regulation of macromolecule biosynthetic process
GO:0031328	0.512	positive regulation of cellular biosynthetic process
GO:0051254	0.512	positive regulation of RNA metabolic process
GO:0048523	0.501	negative regulation of cellular process
GO:0045893	0.490	positive regulation of DNA-templated transcription
GO:0045944	0.342	positive regulation of transcription by RNA polymerase II
GO:0050896	0.300	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.989	nucleoplasm
GO:0032991	0.930	protein-containing complex
GO:0005737	0.739	cytoplasm
GO:0012505	0.314	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]