StarFunc result for job id P14867

User Input

>input (456 residues)
MRKSPGLSDCLWAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPG
LGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHAC
PLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVM
TTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDP
LIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKID
RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14867	1.000	1.000	6.397E-89	456	1.000	1.000	P14867.pdb.gz	GBRA1_HUMAN Gamma-aminobutyric acid receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=GABRA1 PE=1 SV=3
2	AFDB:Q08BJ3	0.819	0.814	3.178E-74	459	0.857	0.852	Q08BJ3.pdb.gz	Q08BJ3_DANRE Gamma-aminobutyric acid receptor subunit alpha-1 OS=Danio rerio OX=7955 GN=zgc:153566 PE=1 SV=1
3	AFDB:P23576	0.791	0.799	2.946E-70	451	0.746	0.754	P23576.pdb.gz	GBRA2_RAT Gamma-aminobutyric acid receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Gabra2 PE=1 SV=1
4	AFDB:P19969	0.800	0.786	2.041E-65	464	0.686	0.675	P19969.pdb.gz	GBRA5_RAT Gamma-aminobutyric acid receptor subunit alpha-5 OS=Rattus norvegicus OX=10116 GN=Gabra5 PE=2 SV=1
5	AFDB:P20236	0.757	0.700	2.424E-65	493	0.700	0.647	P20236.pdb.gz	GBRA3_RAT Gamma-aminobutyric acid receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Gabra3 PE=1 SV=2
6	PDB:6i53A	0.753	0.981	8.261E-64	349	0.761	0.994	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
7	AFDB:P16305	0.747	0.752	3.346E-60	453	0.564	0.567	P16305.pdb.gz	GBRA6_MOUSE Gamma-aminobutyric acid receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Gabra6 PE=1 SV=3
8	AFDB:P48169	0.748	0.618	9.967E-60	554	0.594	0.489	P48169.pdb.gz	GBRA4_HUMAN Gamma-aminobutyric acid receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=GABRA4 PE=1 SV=2
9	AFDB:P28471	0.723	0.598	1.056E-59	552	0.596	0.493	P28471.pdb.gz	GBRA4_RAT Gamma-aminobutyric acid receptor subunit alpha-4 OS=Rattus norvegicus OX=10116 GN=Gabra4 PE=1 SV=1
10	AFDB:F1RDP2	0.718	0.687	4.262E-50	477	0.447	0.428	F1RDP2.pdb.gz	F1RDP2_DANRE Gamma-aminobutyric acid receptor subunit gamma-2 isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-145n14.1 PE=3 SV=3
11	AFDB:P22723	0.713	0.686	4.262E-50	474	0.445	0.428	P22723.pdb.gz	GBRG2_MOUSE Gamma-aminobutyric acid receptor subunit gamma-2 OS=Mus musculus OX=10090 GN=Gabrg2 PE=1 SV=3
12	PDB:6i53B	0.702	0.941	1.103E-38	338	0.316	0.426	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:7kuyE	0.646	0.862	2.002E-30	338	0.230	0.311	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
14	PDB:4hfcA	0.611	0.880	5.430E-22	311	0.151	0.222	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:7l6qA	0.491	0.705	1.262E-17	311	0.118	0.174	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
16	PDB:6zgdA	0.549	0.844	8.823E-15	288	0.138	0.219	6zgdA.pdb.gz
17	PDB:4aq5E	0.538	0.652	2.482E-14	370	0.114	0.141	4aq5E.pdb.gz
18	PDB:2w8gC	0.390	0.784	8.293E-14	217	0.086	0.180	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
19	PDB:4afhA	0.381	0.773	2.771E-13	213	0.094	0.202	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
20	PDB:7rwaM	0.110	0.127	4.483E-5	379	0.068	0.082	7rwaM.pdb.gz	Structural basis of an endocytic checkpoint that primes the AP2 clathrin adaptor for cargo internalization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P14867	0.0	948	456	1.000	1.000	GBRA1_HUMAN Gamma-aminobutyric acid receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=GABRA1 PE=1 SV=3
2	P16305	0.0	518	453	0.570	0.574	GBRA6_MOUSE Gamma-aminobutyric acid receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Gabra6 PE=1 SV=3
3	P19969	0.0	636	464	0.700	0.688	GBRA5_RAT Gamma-aminobutyric acid receptor subunit alpha-5 OS=Rattus norvegicus OX=10116 GN=Gabra5 PE=2 SV=1
4	P20236	0.0	630	493	0.706	0.653	GBRA3_RAT Gamma-aminobutyric acid receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Gabra3 PE=1 SV=2
5	P23576	0.0	669	451	0.746	0.754	GBRA2_RAT Gamma-aminobutyric acid receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Gabra2 PE=1 SV=1
6	P26048	0.0	669	451	0.746	0.754	GBRA2_MOUSE Gamma-aminobutyric acid receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Gabra2 PE=1 SV=1
7	P26049	0.0	630	492	0.711	0.659	GBRA3_MOUSE Gamma-aminobutyric acid receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Gabra3 PE=1 SV=1
8	P30191	0.0	520	453	0.564	0.567	GBRA6_RAT Gamma-aminobutyric acid receptor subunit alpha-6 OS=Rattus norvegicus OX=10116 GN=Gabra6 PE=1 SV=1
9	P31644	0.0	638	462	0.700	0.690	GBRA5_HUMAN Gamma-aminobutyric acid receptor subunit alpha-5 OS=Homo sapiens OX=9606 GN=GABRA5 PE=1 SV=1
10	P34903	0.0	632	492	0.711	0.659	GBRA3_HUMAN Gamma-aminobutyric acid receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=GABRA3 PE=1 SV=1
11	P47869	0.0	670	451	0.746	0.754	GBRA2_HUMAN Gamma-aminobutyric acid receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=GABRA2 PE=1 SV=2
12	P62812	0.0	929	455	0.985	0.987	GBRA1_MOUSE Gamma-aminobutyric acid receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Gabra1 PE=1 SV=1
13	P62813	0.0	929	455	0.985	0.987	GBRA1_RAT Gamma-aminobutyric acid receptor subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Gabra1 PE=1 SV=1
14	Q08BJ3	0.0	706	459	0.838	0.832	Q08BJ3_DANRE Gamma-aminobutyric acid receptor subunit alpha-1 OS=Danio rerio OX=7955 GN=zgc:153566 PE=1 SV=1
15	Q16445	0.0	516	453	0.566	0.570	GBRA6_HUMAN Gamma-aminobutyric acid receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=GABRA6 PE=2 SV=2
16	Q8BHJ7	0.0	640	463	0.704	0.693	GBRA5_MOUSE Gamma-aminobutyric acid receptor subunit alpha-5 OS=Mus musculus OX=10090 GN=Gabra5 PE=1 SV=1
17	P48169	7.75e-176	506	554	0.524	0.431	GBRA4_HUMAN Gamma-aminobutyric acid receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=GABRA4 PE=1 SV=2
18	P28471	7.91e-176	506	552	0.513	0.424	GBRA4_RAT Gamma-aminobutyric acid receptor subunit alpha-4 OS=Rattus norvegicus OX=10116 GN=Gabra4 PE=1 SV=1
19	Q9D6F4	2.20e-175	504	552	0.518	0.428	GBRA4_MOUSE Gamma-aminobutyric acid receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Gabra4 PE=2 SV=1
20	F1RDP2	7.28e-127	378	477	0.461	0.440	F1RDP2_DANRE Gamma-aminobutyric acid receptor subunit gamma-2 isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-145n14.1 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	1.2e-46	170.5	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	4.8e-36	136.6	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000017922

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000017923	0.992	Gamma-aminobutyric acid receptor subunit gamma-2
2	9601.ENSPPYP00000007112	0.963	Uncharacterized protein
3	9601.ENSPPYP00000006724	0.905	Catalyzes two steps in the biosynthesis of the molybdenum cofactor. In the first step, molybdopterin is adenylated. Subsequently, molybdate is inserted into adenylated molybdopterin and AMP is released
4	9601.ENSPPYP00000016427	0.901	Belongs to the ligand-gated ion channel (TC 1.A.9) family.
5	9601.ENSPPYP00000017919	0.895	Gamma-aminobutyric acid (GABA) A receptor, beta 2
6	9601.ENSPPYP00000008889	0.877	GABA(A) receptor-associated protein
7	9601.ENSPPYP00000009318	0.859	Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin. Interaction with AMPAR subunit GRIA2 leads to influence GRIA2 membrane cycling (By similarity)
8	9601.ENSPPYP00000004869	0.829	Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity)
9	9601.ENSPPYP00000007689	0.829	Gamma-aminobutyric acid receptor-associated protein-like 1
10	9601.ENSPPYP00000008538	0.744	GABA(A) receptor-associated protein-like 2
11	9601.ENSPPYP00000016431	0.731	Gamma-aminobutyric acid (GABA) A receptor, beta 1
12	9601.ENSPPYP00000016430	0.726	Gamma-aminobutyric acid (GABA) A receptor, alpha 4
13	9601.ENSPPYP00000023844	0.725	Pongo abelii trafficking protein, kinesin binding 2 (TRAK2), mRNA
14	9601.ENSPPYP00000017920	0.724	Gamma-aminobutyric acid (GABA) A receptor, alpha 6
15	9601.ENSPPYP00000007113	0.713	Gamma-aminobutyric acid (GABA) A receptor, alpha 5
16	9601.ENSPPYP00000023312	0.705	Gamma-aminobutyric acid (GABA) A receptor, alpha 3
17	9601.ENSPPYP00000023313	0.675	Gamma-aminobutyric acid (GABA) A receptor, theta
18	9601.ENSPPYP00000022016	0.674	Uncharacterized protein
19	9601.ENSPPYP00000021651	0.667	Plays an important role in the regulation of different protein degradation mechanisms and pathways including ubiquitin- proteasome system (UPS), autophagy and endoplasmic reticulum-associated protein degradation (ERAD) pathway. Mediates the proteasomal targeting of misfolded or accumulated proteins for degradation by binding (via UBA domain) to their polyubiquitin chains and by interacting (via ubiquitin-like domain) with the subunits of the proteasome. Plays a role in the ERAD pathway via its interaction with ER-localized proteins UBXN4, VCP and HERPUD1 and may form a link between the [...]
20	9601.ENSPPYP00000014583	0.616	Phospholipase C-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0022851	0.995	GABA-gated chloride ion channel activity
GO:0099529	0.983	neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential
GO:1904315	0.884	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
GO:0004890	0.852	GABA-A receptor activity
GO:0008324	0.575	monoatomic cation transmembrane transporter activity
GO:0005231	0.339	excitatory extracellular ligand-gated monoatomic ion channel activity
GO:0005261	0.317	monoatomic cation channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0007154	0.958	cell communication
GO:0065007	0.957	biological regulation
GO:0023052	0.955	signaling
GO:0032501	0.916	multicellular organismal process
GO:0007267	0.895	cell-cell signaling
GO:0050789	0.890	regulation of biological process
GO:0050896	0.857	response to stimulus
GO:0050794	0.816	regulation of cellular process
GO:0071840	0.793	cellular component organization or biogenesis
GO:0048856	0.783	anatomical structure development
GO:0016043	0.783	cellular component organization
GO:0034330	0.765	cell junction organization
GO:0051716	0.761	cellular response to stimulus
GO:0007275	0.751	multicellular organism development
GO:0051179	0.701	localization
GO:0099536	0.635	synaptic signaling
GO:0048731	0.633	system development
GO:0051234	0.620	establishment of localization
GO:0006810	0.613	transport
GO:0007399	0.604	nervous system development
GO:0006811	0.603	monoatomic ion transport
GO:0007214	0.487	gamma-aminobutyric acid signaling pathway
GO:0098916	0.485	anterograde trans-synaptic signaling
GO:0065008	0.433	regulation of biological quality
GO:0044085	0.407	cellular component biogenesis
GO:0007165	0.406	signal transduction
GO:0022607	0.400	cellular component assembly
GO:0007416	0.379	synapse assembly
GO:0015698	0.350	inorganic anion transport
GO:0006820	0.349	monoatomic anion transport
GO:0007268	0.332	chemical synaptic transmission
GO:0055085	0.329	transmembrane transport
GO:0098660	0.309	inorganic ion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043226	0.988	organelle
GO:0043235	0.972	receptor complex
GO:0030054	0.935	cell junction
GO:0045202	0.932	synapse
GO:0043227	0.903	membrane-bounded organelle
GO:0098982	0.809	GABA-ergic synapse
GO:0045211	0.786	postsynaptic membrane
GO:0099634	0.759	postsynaptic specialization membrane
GO:0005622	0.756	intracellular anatomical structure
GO:0043229	0.699	intracellular organelle
GO:0043231	0.675	intracellular membrane-bounded organelle
GO:1902710	0.668	GABA receptor complex
GO:0005737	0.636	cytoplasm
GO:0042995	0.338	cell projection
GO:0120025	0.328	plasma membrane bounded cell projection
GO:0005829	0.303	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	1.000	chloride(in) = chloride(out)

[back to server]