StarFunc result for job id P14868

User Input

>input (501 residues)
MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVV
WVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVV
RKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRL
DNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYF
KNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYH
EVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGV
EMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFM
RGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLF
LGLHNVRQTSMFPRDPKRLTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJW5	0.973	0.973	3.325E-102	501	1.000	1.000	A0A140VJW5.pdb.gz	A0A140VJW5_HUMAN Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 PE=2 SV=1
2	PDB:4j15A	0.844	0.980	9.752E-82	431	0.852	0.991	4j15A.pdb.gz
3	AFDB:Q7K0E6	0.953	0.900	5.011E-80	531	0.665	0.627	Q7K0E6.pdb.gz	Q7K0E6_DROME Aspartate--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=AspRS PE=1 SV=1
4	AFDB:O74407	0.941	0.814	1.100E-69	580	0.519	0.448	O74407.pdb.gz	SYDC_SCHPO Aspartate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dps1 PE=1 SV=1
5	AFDB:P04802	0.950	0.855	1.303E-69	557	0.565	0.508	P04802.pdb.gz	SYDC_YEAST Aspartate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DPS1 PE=1 SV=3
6	AFDB:Q75JQ1	0.930	0.810	1.935E-69	576	0.523	0.455	Q75JQ1.pdb.gz	SYDC1_DICDI Aspartate--tRNA ligase, cytoplasmic 1 OS=Dictyostelium discoideum OX=44689 GN=aspS1 PE=3 SV=1
7	AFDB:Q8H104	0.936	0.882	9.393E-69	532	0.473	0.445	Q8H104.pdb.gz	SYDC1_ARATH Aspartate--tRNA ligase 1, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g26870 PE=2 SV=1
8	AFDB:Q585M3	0.919	0.823	5.401E-68	560	0.477	0.427	Q585M3.pdb.gz	Q585M3_TRYB2 aspartate--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.1030 PE=3 SV=1
9	AFDB:Q9M084	0.942	0.847	3.359E-65	558	0.491	0.441	Q9M084.pdb.gz	SYDC2_ARATH Aspartate--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=IBI1 PE=1 SV=1
10	AFDB:Q8I2B1	0.902	0.725	2.996E-60	626	0.445	0.356	Q8I2B1.pdb.gz	Q8I2B1_PLAF7 aspartate--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0102900 PE=3 SV=1
11	AFDB:Q38CB4	0.823	0.765	2.466E-52	541	0.375	0.348	Q38CB4.pdb.gz	Q38CB4_TRYB2 aspartate--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6800 PE=3 SV=1
12	PDB:5zg8A	0.744	0.875	2.653E-36	422	0.269	0.320	5zg8A.pdb.gz
13	PDB:1e1tA	0.644	0.664	1.705E-30	485	0.218	0.225	1e1tA.pdb.gz	Active Site of Lysyl-tRNA Synthetase: Structural Studies of the Adenylation Reaction
14	PDB:5w25A	0.686	0.594	2.137E-30	583	0.234	0.201	5w25A.pdb.gz	Crystal structure of Aspartyl-tRNA synthetase from Mycobacterium tuberculosis complexed with L-Aspartic Acid
15	PDB:6chdA	0.675	0.669	2.531E-30	506	0.188	0.186	6chdA.pdb.gz	Crystal Structure of Human Lysyl-tRNA Synthetase complexed with L-Lysylsulfamoyl Adenosine
16	PDB:1bbuA	0.611	0.628	4.981E-30	486	0.206	0.212	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.
17	PDB:1eqrA	0.678	0.582	5.965E-29	590	0.226	0.192	1eqrA.pdb.gz
18	PDB:4ah6A	0.664	0.570	3.430E-28	589	0.236	0.200	4ah6A.pdb.gz
19	PDB:3a5zC	0.446	0.661	1.106E-18	324	0.112	0.173	3a5zC.pdb.gz	A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.
20	PDB:3a5yA	0.455	0.734	2.080E-17	297	0.106	0.178	3a5yA.pdb.gz	A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJW5	0.0	1045	501	1.000	1.000	A0A140VJW5_HUMAN Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 PE=2 SV=1
2	P04802	0.0	560	557	0.569	0.512	SYDC_YEAST Aspartate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DPS1 PE=1 SV=3
3	P14868	0.0	1045	501	1.000	1.000	SYDC_HUMAN Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2
4	P15178	0.0	1011	501	0.956	0.956	SYDC_RAT Aspartate--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Dars1 PE=1 SV=1
5	Q7K0E6	0.0	706	531	0.665	0.627	Q7K0E6_DROME Aspartate--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=AspRS PE=1 SV=1
6	Q922B2	0.0	1013	501	0.960	0.960	SYDC_MOUSE Aspartate--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Dars1 PE=1 SV=2
7	Q9XYM1	0.0	706	531	0.663	0.625	Q9XYM1_DROME Aspartate--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=AspRS PE=2 SV=1
8	Q75JQ1	4.86e-179	516	576	0.533	0.464	SYDC1_DICDI Aspartate--tRNA ligase, cytoplasmic 1 OS=Dictyostelium discoideum OX=44689 GN=aspS1 PE=3 SV=1
9	O74407	1.73e-177	513	580	0.525	0.453	SYDC_SCHPO Aspartate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dps1 PE=1 SV=1
10	Q8H104	1.02e-161	471	532	0.465	0.438	SYDC1_ARATH Aspartate--tRNA ligase 1, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g26870 PE=2 SV=1
11	Q9M084	3.02e-159	465	558	0.479	0.430	SYDC2_ARATH Aspartate--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=IBI1 PE=1 SV=1
12	Q585M3	2.49e-158	463	560	0.485	0.434	Q585M3_TRYB2 aspartate--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.1030 PE=3 SV=1
13	Q8I2B1	5.59e-140	418	626	0.425	0.340	Q8I2B1_PLAF7 aspartate--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0102900 PE=3 SV=1
14	Q38CB4	7.21e-101	315	541	0.369	0.342	Q38CB4_TRYB2 aspartate--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6800 PE=3 SV=1
15	P54263	3.80e-49	176	438	0.285	0.326	SYN_THET8 Asparagine--tRNA ligase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=asnS PE=1 SV=2
16	Q97PR0	3.60e-43	160	447	0.261	0.293	SYN_STRPN Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=asnS PE=1 SV=1
17	P38707	3.85e-43	162	554	0.279	0.253	SYNC_YEAST Asparagine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DED81 PE=1 SV=1
18	Q8BP47	5.13e-42	159	559	0.196	0.175	SYNC_MOUSE Asparagine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=NARS1 PE=1 SV=2
19	Q584F6	2.15e-40	157	746	0.251	0.169	Q584F6_TRYB2 asparagine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.630 PE=4 SV=1
20	O43776	5.72e-40	154	548	0.248	0.226	SYNC_HUMAN Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=NARS1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00438 S-AdoMet_synt_N	8.6	18.3	S-adenosylmethionine synthetase, N-terminal domain
2	PF00152 tRNA-synt_2	1.1e-76	269.5	tRNA synthetases class II (D, K and N)
3	PF01409 tRNA-synt_2d	0.17	22.9	tRNA synthetases class II core domain (F)
4	PF01336 tRNA_anti-codon	4.2e-05	34.8	OB-fold nucleic acid binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264161

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223029	0.999	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
2	9606.ENSP00000231572	0.999	Arginine--tRNA ligase, cytoplasmic
3	9606.ENSP00000262027	0.999	Methionine--tRNA ligase, cytoplasmic
4	9606.ENSP00000307567	0.999	Glutamine--tRNA ligase
5	9606.ENSP00000355890	0.999	Bifunctional glutamate/proline--tRNA ligase
6	9606.ENSP00000364794	0.999	Isoleucine--tRNA ligase, cytoplasmic
7	9606.ENSP00000369038	0.999	Eukaryotic translation elongation factor 1 epsilon-1
8	9606.ENSP00000377954	0.999	Leucine--tRNA ligase, cytoplasmic
9	9606.ENSP00000378191	0.997	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1
10	9606.ENSP00000325448	0.995	Lysine--tRNA ligase
11	9606.ENSP00000261772	0.956	Alanine--tRNA ligase, cytoplasmic
12	9606.ENSP00000373918	0.947	Glycine--tRNA ligase
13	9606.ENSP00000244571	0.928	Alanine--tRNA ligase, mitochondrial
14	9606.ENSP00000362576	0.914	Tyrosine--tRNA ligase, cytoplasmic
15	9606.ENSP00000355086	0.888	Aspartate--tRNA ligase, mitochondrial
16	9606.ENSP00000364815	0.869	Valine--tRNA ligase
17	9606.ENSP00000263985	0.853	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
18	9606.ENSP00000358549	0.849	Probable arginine--tRNA ligase, mitochondrial
19	9606.ENSP00000355889	0.846	Isoleucine--tRNA ligase, mitochondrial
20	9606.ENSP00000395196	0.837	Probable glutamate--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004812	0.999	aminoacyl-tRNA ligase activity
GO:0005515	0.996	protein binding
GO:0004815	0.965	aspartate-tRNA ligase activity
GO:0097159	0.960	organic cyclic compound binding
GO:1901363	0.959	heterocyclic compound binding
GO:0003723	0.935	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0019538	0.989	protein metabolic process
GO:1901576	0.985	organic substance biosynthetic process
GO:0090304	0.985	nucleic acid metabolic process
GO:0044260	0.983	cellular macromolecule metabolic process
GO:0010467	0.980	gene expression
GO:0044271	0.979	cellular nitrogen compound biosynthetic process
GO:0009059	0.978	macromolecule biosynthetic process
GO:1901566	0.978	organonitrogen compound biosynthetic process
GO:0019752	0.978	carboxylic acid metabolic process
GO:0034660	0.978	ncRNA metabolic process
GO:0043603	0.975	amide metabolic process
GO:0043039	0.973	tRNA aminoacylation
GO:0006412	0.969	translation
GO:0006418	0.946	tRNA aminoacylation for protein translation
GO:0016043	0.746	cellular component organization
GO:0043933	0.711	protein-containing complex organization
GO:0044085	0.648	cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:1902494	0.995	catalytic complex
GO:0140535	0.995	intracellular protein-containing complex
GO:0005829	0.987	cytosol
GO:0017101	0.966	aminoacyl-tRNA synthetase multienzyme complex
GO:0043227	0.946	membrane-bounded organelle
GO:0005576	0.845	extracellular region
GO:0043231	0.805	intracellular membrane-bounded organelle
GO:0065010	0.770	extracellular membrane-bounded organelle
GO:1903561	0.764	extracellular vesicle
GO:0070062	0.749	extracellular exosome
GO:0070013	0.537	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.1.1.-	0.999	Ligases forming aminoacyl-tRNA and related compounds.
RHEA:19649	0.965	ATP + L-aspartate + tRNA(Asp) = AMP + diphosphate + L-aspartyl-tRNA(Asp)
EC:6.1.1.12	0.965	aspartate--tRNA ligase.

[back to server]