StarFunc result for job id P14921

User Input

>input (441 residues)
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDF
VGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGR
TSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKP
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
LLGYTPEELHAMLDVKPDADE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14921	1.000	1.000	2.873E-66	441	1.000	1.000	P14921.pdb.gz	ETS1_HUMAN Protein C-ets-1 OS=Homo sapiens OX=9606 GN=ETS1 PE=1 SV=1
2	AFDB:P51023	0.263	0.183	3.447E-24	718	0.444	0.273	P51023.pdb.gz	PNT_DROME ETS-like protein pointed OS=Drosophila melanogaster OX=7227 GN=pnt PE=1 SV=2
3	AFDB:B2GTA2	0.201	0.200	8.712E-14	444	0.222	0.221	B2GTA2.pdb.gz
4	AFDB:P97360	0.211	0.194	1.577E-13	485	0.227	0.206	P97360.pdb.gz	ETV6_MOUSE Transcription factor ETV6 OS=Mus musculus OX=10090 GN=Etv6 PE=1 SV=1
5	AFDB:A0A0S2Z3C9	0.201	0.196	2.428E-13	452	0.213	0.208	A0A0S2Z3C9.pdb.gz	A0A0S2Z3C9_HUMAN Ets variant 6 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ETV6 PE=2 SV=1
6	AFDB:Q22355	0.198	0.229	4.802E-11	377	0.202	0.236	Q22355.pdb.gz	AST1_CAEEL Transcription factor ast-1 OS=Caenorhabditis elegans OX=6239 GN=ast-1 PE=1 SV=2
7	AFDB:P41164	0.205	0.190	9.332E-10	477	0.190	0.176	P41164.pdb.gz	ETV1_MOUSE ETS translocation variant 1 OS=Mus musculus OX=10090 GN=Etv1 PE=1 SV=1
8	AFDB:O00321	0.210	0.264	9.850E-10	342	0.193	0.249	O00321.pdb.gz	ETV2_HUMAN ETS translocation variant 2 OS=Homo sapiens OX=9606 GN=ETV2 PE=2 SV=2
9	AFDB:Q8MRW5	0.212	0.150	7.651E-9	640	0.190	0.131	Q8MRW5.pdb.gz	ET96B_DROME ETV5-related protein Ets96B OS=Drosophila melanogaster OX=7227 GN=Ets96B PE=2 SV=1
10	AFDB:Q15723	0.200	0.150	2.459E-6	593	0.184	0.137	Q15723.pdb.gz	ELF2_HUMAN ETS-related transcription factor Elf-2 OS=Homo sapiens OX=9606 GN=ELF2 PE=1 SV=2
11	PDB:2qb0B	0.147	0.265	3.318E-3	241	0.063	0.116	2qb0B.pdb.gz	Polymer-driven crystallization.
12	PDB:4mtdD	0.128	0.288	7.308E-1	151	0.034	0.099	4mtdD.pdb.gz	Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.
13	PDB:5h3rA	0.128	0.313	1.066	141	0.050	0.156	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
14	PDB:1jhfA	0.101	0.216	1.323	197	0.020	0.046	1jhfA.pdb.gz
15	PDB:4cguA	0.077	0.226	1.396	112	0.036	0.143	4cguA.pdb.gz	Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
16	PDB:1r1uC	0.074	0.282	1.474	98	0.018	0.082	1r1uC.pdb.gz
17	PDB:2fe3B	0.125	0.295	1.474	143	0.036	0.112	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
18	PDB:5hs7A	0.120	0.379	1.732	102	0.023	0.098	5hs7A.pdb.gz
19	PDB:5datC0	0.076	0.300	1.828	96	0.018	0.083	5datC0.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
20	PDB:4zzlA	0.087	0.214	2.150	146	0.027	0.082	4zzlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P14921	0.0	919	441	1.000	1.000	ETS1_HUMAN Protein C-ets-1 OS=Homo sapiens OX=9606 GN=ETS1 PE=1 SV=1
2	P27577	0.0	894	440	0.971	0.973	ETS1_MOUSE Protein C-ets-1 OS=Mus musculus OX=10090 GN=Ets1 PE=1 SV=2
3	P41156	0.0	911	441	0.989	0.989	ETS1_RAT Protein C-ets-1 OS=Rattus norvegicus OX=10116 GN=Ets1 PE=1 SV=1
4	Q568B4	4.11e-176	497	334	0.583	0.769	Q568B4_DANRE Ets1a protein OS=Danio rerio OX=7955 GN=ets1a PE=2 SV=1
5	P10157	7.11e-152	441	479	0.540	0.497	ETS2_CHICK Protein C-ets-2 OS=Gallus gallus OX=9031 GN=ETS2 PE=2 SV=1
6	A0A8I6GB76	3.58e-151	440	492	0.535	0.480	A0A8I6GB76_RAT ETS proto-oncogene 2, transcription factor OS=Rattus norvegicus OX=10116 GN=Ets2 PE=3 SV=1
7	A0A8I5ZS11	7.68e-151	439	494	0.535	0.478	A0A8I5ZS11_RAT ETS proto-oncogene 2, transcription factor OS=Rattus norvegicus OX=10116 GN=Ets2 PE=3 SV=1
8	P15036	1.81e-148	432	469	0.528	0.497	ETS2_HUMAN Protein C-ets-2 OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1
9	P15037	2.91e-144	421	468	0.522	0.491	ETS2_MOUSE Protein C-ets-2 OS=Mus musculus OX=10090 GN=Ets2 PE=1 SV=1
10	A0A590UJP9	6.72e-141	414	504	0.528	0.462	A0A590UJP9_HUMAN ETS proto-oncogene 2, transcription factor OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1
11	D4AAH4	7.24e-113	340	424	0.454	0.472	D4AAH4_RAT ETS proto-oncogene 2, transcription factor OS=Rattus norvegicus OX=10116 GN=Ets2 PE=3 SV=2
12	P51023	2.36e-57	202	718	0.218	0.134	PNT_DROME ETS-like protein pointed OS=Drosophila melanogaster OX=7227 GN=pnt PE=1 SV=2
13	A0A2R8Q5A3	4.77e-54	186	355	0.195	0.242	A0A2R8Q5A3_DANRE ETS variant transcription factor 2 OS=Danio rerio OX=7955 GN=ets1b PE=3 SV=1
14	Q30JB6	6.80e-54	186	366	0.195	0.235	Q30JB6_DANRE ETS variant transcription factor 2 OS=Danio rerio OX=7955 GN=etv2 PE=2 SV=1
15	C9JAG2	3.50e-43	154	270	0.179	0.293	C9JAG2_HUMAN ETS proto-oncogene 2, transcription factor (Fragment) OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1
16	A0A0C4DG47	7.42e-43	150	168	0.163	0.429	A0A0C4DG47_HUMAN ETS proto-oncogene 2, transcription factor (Fragment) OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1
17	A8IE48	2.82e-39	149	454	0.147	0.143	A8IE48_HUMAN GA binding protein transcription factor alpha subunit 60kDa OS=Homo sapiens OX=9606 GN=GABPA PE=2 SV=1
18	Q06546	2.82e-39	149	454	0.147	0.143	GABPA_HUMAN GA-binding protein alpha chain OS=Homo sapiens OX=9606 GN=GABPA PE=1 SV=1
19	Q00422	3.28e-39	149	454	0.147	0.143	GABPA_MOUSE GA-binding protein alpha chain OS=Mus musculus OX=10090 GN=Gabpa PE=1 SV=2
20	Q99581	2.09e-35	133	238	0.143	0.265	FEV_HUMAN Protein FEV OS=Homo sapiens OX=9606 GN=FEV PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00178 Ets	3e-31	118.9	Ets-domain
2	PF19525 Ets1_N_flank	4.1e-119	406.5	Ets1 N-terminal flanking region of Ets domain
3	PF00447 HSF_DNA-bind	1.1e+02	14.7	HSF-type DNA-binding
4	PF02198 SAM_PNT	9.1e-30	113.8	Sterile alpha motif (SAM)/Pointed domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000009098

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000288	0.983	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
2	61853.ENSNLEP00000005245	0.955	Runt-related transcription factor
3	61853.ENSNLEP00000011912	0.943	CREB binding protein
4	61853.ENSNLEP00000004471	0.937	Paired box 5
5	61853.ENSNLEP00000005846	0.932	ETS proto-oncogene 2, transcription factor
6	61853.ENSNLEP00000001356	0.916	Forkhead box O1
7	61853.ENSNLEP00000005105	0.914	Serum response factor (c-fos serum response element-binding transcription factor)
8	61853.ENSNLEP00000017965	0.902	Jun proto-oncogene, AP-1 transcription factor subunit
9	61853.ENSNLEP00000002370	0.860	Mitogen-activated protein kinase 3
10	61853.ENSNLEP00000018748	0.860	E1A binding protein p300
11	61853.ENSNLEP00000019981	0.831	Fos proto-oncogene, AP-1 transcription factor subunit
12	61853.ENSNLEP00000017976	0.823	Uncharacterized protein
13	61853.ENSNLEP00000010109	0.819	HRas proto-oncogene, GTPase
14	61853.ENSNLEP00000008348	0.811	Death-domain associated protein
15	61853.ENSNLEP00000011861	0.806	Cellular tumor antigen p53
16	61853.ENSNLEP00000021481	0.798	Sp1 transcription factor
17	61853.ENSNLEP00000018358	0.772	Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
18	61853.ENSNLEP00000006371	0.728	KRAS proto-oncogene, GTPase
19	61853.ENSNLEP00000010857	0.728	Mitogen-activated protein kinase 14
20	61853.ENSNLEP00000021135	0.719	Signal transducer and activator of transcription 6, interleukin-4 induced

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	1.000	transcription factor binding
GO:0000981	0.998	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.997	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.989	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140297	0.987	DNA-binding transcription factor binding
GO:0001228	0.987	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0061629	0.983	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0042802	0.911	identical protein binding
GO:0003713	0.898	transcription coactivator activity
GO:0001221	0.813	transcription coregulator binding
GO:0030374	0.751	nuclear receptor coactivator activity
GO:0001222	0.732	transcription corepressor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0032501	0.986	multicellular organismal process
GO:0050794	0.986	regulation of cellular process
GO:0007275	0.983	multicellular organism development
GO:0006355	0.978	regulation of DNA-templated transcription
GO:0009893	0.975	positive regulation of metabolic process
GO:0010557	0.966	positive regulation of macromolecule biosynthetic process
GO:0045935	0.966	positive regulation of nucleobase-containing compound metabolic process
GO:0048731	0.965	system development
GO:0051254	0.960	positive regulation of RNA metabolic process
GO:0009987	0.950	cellular process
GO:0006357	0.941	regulation of transcription by RNA polymerase II
GO:0045893	0.941	positive regulation of DNA-templated transcription
GO:0050896	0.927	response to stimulus
GO:0045944	0.905	positive regulation of transcription by RNA polymerase II
GO:0048519	0.901	negative regulation of biological process
GO:0048523	0.884	negative regulation of cellular process
GO:0042221	0.874	response to chemical
GO:0048583	0.874	regulation of response to stimulus
GO:2000026	0.865	regulation of multicellular organismal development
GO:0048513	0.862	animal organ development
GO:0006950	0.847	response to stress
GO:0071704	0.837	organic substance metabolic process
GO:0051716	0.820	cellular response to stimulus
GO:0044237	0.819	cellular metabolic process
GO:0010628	0.819	positive regulation of gene expression
GO:0044238	0.805	primary metabolic process
GO:0006807	0.804	nitrogen compound metabolic process
GO:0009653	0.798	anatomical structure morphogenesis
GO:0051240	0.791	positive regulation of multicellular organismal process
GO:0048869	0.786	cellular developmental process
GO:0042127	0.784	regulation of cell population proliferation
GO:0045595	0.758	regulation of cell differentiation
GO:0010033	0.755	response to organic substance
GO:0030154	0.755	cell differentiation
GO:0043170	0.752	macromolecule metabolic process
GO:0070887	0.735	cellular response to chemical stimulus
GO:0051094	0.716	positive regulation of developmental process
GO:0002682	0.649	regulation of immune system process
GO:0002376	0.633	immune system process
GO:0010941	0.612	regulation of cell death
GO:0045597	0.592	positive regulation of cell differentiation
GO:0048584	0.575	positive regulation of response to stimulus
GO:0042981	0.575	regulation of apoptotic process
GO:0007154	0.559	cell communication
GO:0022603	0.556	regulation of anatomical structure morphogenesis
GO:1901360	0.543	organic cyclic compound metabolic process
GO:0006725	0.543	cellular aromatic compound metabolic process
GO:0071310	0.539	cellular response to organic substance
GO:0046483	0.535	heterocycle metabolic process
GO:0034641	0.535	cellular nitrogen compound metabolic process
GO:0071840	0.534	cellular component organization or biogenesis
GO:0006139	0.534	nucleobase-containing compound metabolic process
GO:0009892	0.521	negative regulation of metabolic process
GO:0030335	0.517	positive regulation of cell migration
GO:0080134	0.513	regulation of response to stress
GO:0010605	0.513	negative regulation of macromolecule metabolic process
GO:0031324	0.507	negative regulation of cellular metabolic process
GO:0051172	0.506	negative regulation of nitrogen compound metabolic process
GO:0065008	0.500	regulation of biological quality
GO:0010558	0.499	negative regulation of macromolecule biosynthetic process
GO:0031327	0.498	negative regulation of cellular biosynthetic process
GO:0016043	0.495	cellular component organization
GO:1903507	0.485	negative regulation of nucleic acid-templated transcription
GO:0009605	0.469	response to external stimulus
GO:0007165	0.467	signal transduction
GO:0009628	0.461	response to abiotic stimulus
GO:0007399	0.443	nervous system development
GO:0045892	0.441	negative regulation of DNA-templated transcription
GO:0010467	0.437	gene expression
GO:1901700	0.418	response to oxygen-containing compound
GO:0009888	0.415	tissue development
GO:0090304	0.409	nucleic acid metabolic process
GO:1901576	0.405	organic substance biosynthetic process
GO:0044249	0.405	cellular biosynthetic process
GO:0033554	0.379	cellular response to stress
GO:0034654	0.378	nucleobase-containing compound biosynthetic process
GO:0023051	0.375	regulation of signaling
GO:0051128	0.372	regulation of cellular component organization
GO:0010629	0.356	negative regulation of gene expression
GO:0000122	0.353	negative regulation of transcription by RNA polymerase II
GO:0009966	0.346	regulation of signal transduction
GO:0065009	0.338	regulation of molecular function
GO:1901701	0.337	cellular response to oxygen-containing compound
GO:1901564	0.326	organonitrogen compound metabolic process
GO:0006351	0.326	DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.966	nuclear lumen
GO:0005654	0.957	nucleoplasm
GO:0005737	0.946	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]