StarFunc result for job id P14927

User Input

>input (111 residues)
MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRM
FRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14927	1.000	1.000	2.420E-18	111	1.000	1.000	P14927.pdb.gz	QCR7_HUMAN Cytochrome b-c1 complex subunit 7 OS=Homo sapiens OX=9606 GN=UQCRB PE=1 SV=2
2	AFDB:B2RYS2	0.953	0.953	6.421E-16	111	0.847	0.847	B2RYS2.pdb.gz	B2RYS2_RAT Cytochrome b-c1 complex subunit 7 OS=Rattus norvegicus OX=10116 GN=Uqcrb PE=3 SV=1
3	PDB:5xteF	0.918	0.961	1.092E-15	106	0.928	0.972	5xteF.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
4	PDB:7o3cF	0.886	0.963	6.322E-15	102	0.802	0.873	7o3cF.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
5	AFDB:Q4VBV1	0.941	0.941	1.674E-14	111	0.703	0.703	Q4VBV1.pdb.gz	Q4VBV1_DANRE Cytochrome b-c1 complex subunit 7 OS=Danio rerio OX=7955 GN=zgc:109893 PE=1 SV=1
6	AFDB:Q9VAW7	0.842	0.842	5.124E-11	111	0.541	0.541	Q9VAW7.pdb.gz	Q9VAW7_DROME Cytochrome b-c1 complex subunit 7 OS=Drosophila melanogaster OX=7227 GN=UQCR-14L PE=2 SV=1
7	AFDB:Q9VXI6	0.836	0.836	5.124E-11	111	0.541	0.541	Q9VXI6.pdb.gz	Q9VXI6_DROME Cytochrome b-c1 complex subunit 7 OS=Drosophila melanogaster OX=7227 GN=UQCR-14 PE=1 SV=1
8	AFDB:P00128	0.834	0.734	1.641E-8	127	0.342	0.299	P00128.pdb.gz	QCR7_YEAST Cytochrome b-c1 complex subunit 7, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=QCR7 PE=1 SV=2
9	AFDB:Q871K1	0.842	0.764	1.981E-8	123	0.396	0.358	Q871K1.pdb.gz	QCR7_NEUCR Cytochrome b-c1 complex subunit 7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=qcr7 PE=1 SV=1
10	AFDB:O74533	0.843	0.688	2.109E-8	137	0.405	0.328	O74533.pdb.gz	QCR7_SCHPO Cytochrome b-c1 complex subunit 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qcr7 PE=3 SV=1
11	PDB:3cx5G	0.848	0.751	1.109E-7	126	0.342	0.302	3cx5G.pdb.gz	Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
12	AFDB:Q5ABS1	0.854	0.750	1.221E-7	127	0.342	0.299	Q5ABS1.pdb.gz	Q5ABS1_CANAL Cytochrome b-c1 complex subunit 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=QCR7 PE=1 SV=1
13	PDB:7rjaG	0.870	0.794	4.996E-7	122	0.342	0.311	7rjaG.pdb.gz	Rieske head domain dynamics and indazole-derivative inhibition of Candida albicans complex III.
14	AFDB:Q9SUU5	0.748	0.685	2.224E-5	122	0.315	0.287	Q9SUU5.pdb.gz	QCR71_ARATH Cytochrome b-c1 complex subunit 7-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=QCR7-1 PE=1 SV=1
15	PDB:6xf6B	0.153	0.032	3.019	945	0.162	0.019	6xf6B.pdb.gz
16	PDB:7mteB	0.155	0.036	4.131	802	0.171	0.024	7mteB.pdb.gz
17	PDB:6lo8H	0.222	0.319	4.985	74	0.081	0.122	6lo8H.pdb.gz
18	PDB:7mtdB	0.161	0.038	4.985	759	0.171	0.025	7mtdB.pdb.gz
19	PDB:4zc0A	0.226	0.079	5.308	445	0.126	0.031	4zc0A.pdb.gz	Structure and primase-mediated activation of a bacterial dodecameric replicative helicase.
20	PDB:6xf5A	0.153	0.031	5.308	1009	0.171	0.019	6xf5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P14927	1.32e-77	225	111	1.000	1.000	QCR7_HUMAN Cytochrome b-c1 complex subunit 7 OS=Homo sapiens OX=9606 GN=UQCRB PE=1 SV=2
2	B2RYS2	3.20e-69	204	111	0.874	0.874	B2RYS2_RAT Cytochrome b-c1 complex subunit 7 OS=Rattus norvegicus OX=10116 GN=Uqcrb PE=3 SV=1
3	Q9D855	2.21e-68	202	111	0.865	0.865	QCR7_MOUSE Cytochrome b-c1 complex subunit 7 OS=Mus musculus OX=10090 GN=Uqcrb PE=1 SV=3
4	F7FFF0	1.61e-67	200	111	0.865	0.865	F7FFF0_RAT Cytochrome b-c1 complex subunit 7 OS=Rattus norvegicus OX=10116 GN=LOC685596 PE=3 SV=1
5	A0A8I6AL93	7.23e-66	196	105	0.838	0.886	A0A8I6AL93_RAT Cytochrome b-c1 complex subunit 7 OS=Rattus norvegicus OX=10116 GN=Uqcrb PE=1 SV=1
6	Q4VBV1	2.09e-56	172	111	0.721	0.721	Q4VBV1_DANRE Cytochrome b-c1 complex subunit 7 OS=Danio rerio OX=7955 GN=zgc:109893 PE=1 SV=1
7	Q9VAW7	6.70e-38	125	111	0.541	0.541	Q9VAW7_DROME Cytochrome b-c1 complex subunit 7 OS=Drosophila melanogaster OX=7227 GN=UQCR-14L PE=2 SV=1
8	Q9VXI6	6.79e-32	110	111	0.550	0.550	Q9VXI6_DROME Cytochrome b-c1 complex subunit 7 OS=Drosophila melanogaster OX=7227 GN=UQCR-14 PE=1 SV=1
9	O74533	8.28e-22	85.5	137	0.405	0.328	QCR7_SCHPO Cytochrome b-c1 complex subunit 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qcr7 PE=3 SV=1
10	Q871K1	3.81e-20	80.9	123	0.396	0.358	QCR7_NEUCR Cytochrome b-c1 complex subunit 7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=qcr7 PE=1 SV=1
11	P00128	3.06e-15	68.2	127	0.342	0.299	QCR7_YEAST Cytochrome b-c1 complex subunit 7, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=QCR7 PE=1 SV=2
12	Q5ABS1	3.15e-13	63.2	127	0.324	0.283	Q5ABS1_CANAL Cytochrome b-c1 complex subunit 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=QCR7 PE=1 SV=1
13	Q9SUU5	3.82e-09	52.4	122	0.306	0.279	QCR71_ARATH Cytochrome b-c1 complex subunit 7-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=QCR7-1 PE=1 SV=1
14	F4JWS8	4.31e-08	49.7	122	0.279	0.254	QCR72_ARATH Cytochrome b-c1 complex subunit 7-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=QCR7-2 PE=1 SV=1
15	Q38BH2	0.002	38.1	201	0.279	0.154	Q38BH2_TRYB2 Ubiquinol-cytochrome c reductase complex 14 kDa protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2970 PE=3 SV=1
16	C8VKK0	0.54	31.2	401	0.171	0.047	C8VKK0_EMENI 4-hydroxyphenylpyruvate dioxygenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01899 PE=3 SV=1
17	Q4WHU1	0.57	31.2	403	0.171	0.047	HPPD1_ASPFU 4-hydroxyphenylpyruvate dioxygenase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=hppD PE=1 SV=1
18	Q8BX65	0.92	30.4	247	0.108	0.049	MDFIC_MOUSE MyoD family inhibitor domain-containing protein OS=Mus musculus OX=10090 GN=Mdfic PE=1 SV=1
19	Q8N5Z0	2.5	29.3	425	0.144	0.038	AADAT_HUMAN Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=AADAT PE=1 SV=2
20	Q80YA3	5.3	28.5	547	0.126	0.026	DDHD1_MOUSE Phospholipase DDHD1 OS=Mus musculus OX=10090 GN=Ddhd1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02271 UCR_14kD	1.8e-37	138.6	Ubiquinol-cytochrome C reductase complex 14kD subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003821726.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003806186.1	0.999	Cytochrome c oxidase subunit 5B, mitochondrial
2	9597.XP_003807873.1	0.999	Cytochrome b-c1 complex subunit 2, mitochondrial
3	9597.XP_003812052.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 319 ESTs, 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
4	9597.XP_003812798.1	0.999	Cytochrome b-c1 complex subunit 6, mitochondrial isoform X1
5	9597.XP_003816278.1	0.999	[Cytochrome b-c1 complex subunit Rieske, mitochondrial]: Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b- c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemica [...]
6	9597.XP_003819481.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 694 ESTs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
7	9597.XP_003829342.1	0.999	Cytochrome b-c1 complex subunit 8
8	9597.XP_008949936.1	0.999	This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
9	9597.XP_008969959.1	0.999	Cytochrome b-c1 complex subunit 1, mitochondrial
10	9597.XP_003807126.1	0.998	NADH:ubiquinone oxidoreductase subunit B7
11	9597.XP_003815494.1	0.998	NADH:ubiquinone oxidoreductase subunit A5
12	9597.XP_003827402.1	0.998	NADH:ubiquinone oxidoreductase subunit S4
13	9597.XP_003829224.1	0.998	NADH:ubiquinone oxidoreductase subunit A2
14	9597.XP_003833164.1	0.998	NADH:ubiquinone oxidoreductase subunit A8
15	9597.XP_008964832.1	0.997	NADH:ubiquinone oxidoreductase core subunit S7
16	9597.XP_003805071.1	0.996	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 400 ESTs, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
17	9597.XP_003814695.1	0.996	NADH:ubiquinone oxidoreductase subunit A6
18	9597.XP_003822837.1	0.996	Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol- cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c ox [...]
19	9597.XP_008956028.1	0.995	Cytochrome c oxidase subunit 6A1, mitochondrial
20	9597.XP_003807151.1	0.994	Cytochrome c oxidase subunit 6B2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0005515	0.909	protein binding
GO:0044877	0.777	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.966	cellular metabolic process
GO:0009060	0.675	aerobic respiration
GO:0006119	0.614	oxidative phosphorylation
GO:0050896	0.400	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.999	mitochondrial inner membrane
GO:0032991	0.957	protein-containing complex
GO:0005750	0.952	mitochondrial respiratory chain complex III

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]