StarFunc result for job id P15018

User Input

>input (202 residues)
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT
RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQIIAVLAQAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15018	1.000	1.000	1.283E-28	202	1.000	1.000	P15018.pdb.gz	LIF_HUMAN Leukemia inhibitory factor OS=Homo sapiens OX=9606 GN=LIF PE=1 SV=1
2	AFDB:P09056	0.830	0.825	1.929E-21	203	0.797	0.793	P09056.pdb.gz	LIF_MOUSE Leukemia inhibitory factor OS=Mus musculus OX=10090 GN=Lif PE=1 SV=1
3	PDB:2q7nB	0.815	0.912	4.116E-19	180	0.886	0.994	2q7nB.pdb.gz
4	PDB:1a7mA	0.753	0.837	5.518E-15	180	0.752	0.844	1a7mA.pdb.gz
5	AFDB:P83714	0.643	0.637	1.146E-4	204	0.208	0.206	P83714.pdb.gz	CTF2_MOUSE Cardiotrophin-2 OS=Mus musculus OX=10090 GN=Ctf2 PE=1 SV=1
6	AFDB:Q60753	0.506	0.504	7.452E-4	203	0.188	0.187	Q60753.pdb.gz	CTF1_MOUSE Cardiotrophin-1 OS=Mus musculus OX=10090 GN=Ctf1 PE=2 SV=1
7	AFDB:Q16619	0.583	0.586	1.435E-3	201	0.198	0.199	Q16619.pdb.gz	CTF1_HUMAN Cardiotrophin-1 OS=Homo sapiens OX=9606 GN=CTF1 PE=1 SV=1
8	AFDB:Q4QRA1	0.620	0.533	3.334E-3	240	0.144	0.121	Q4QRA1.pdb.gz	Q4QRA1_RAT Growth hormone d12 OS=Rattus norvegicus OX=10116 GN=Prl8a2 PE=2 SV=2
9	AFDB:O54832	0.601	0.517	3.836E-3	240	0.173	0.146	O54832.pdb.gz	O54832_MOUSE Decidual PRL-related protein OS=Mus musculus OX=10090 GN=Prl8a2 PE=1 SV=1
10	AFDB:F1QP70	0.529	0.475	4.848E-3	231	0.144	0.126	F1QP70.pdb.gz
11	AFDB:P09919	0.607	0.595	1.074E-2	207	0.129	0.126	P09919.pdb.gz	CSF3_HUMAN Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1
12	AFDB:P33579	0.638	0.551	1.126E-2	238	0.134	0.113	P33579.pdb.gz	PR8A5_RAT Prolactin-8A5 OS=Rattus norvegicus OX=10116 GN=Prl8a5 PE=1 SV=1
13	PDB:1cnt1	0.553	0.729	2.813E-2	150	0.104	0.140	1cnt1.pdb.gz
14	PDB:4cniC	0.537	0.617	9.502E-2	171	0.109	0.129	4cniC.pdb.gz
15	PDB:6o4oA	0.404	0.464	1.146E-1	169	0.104	0.124	6o4oA.pdb.gz
16	PDB:1gncA	0.474	0.531	1.201E-1	175	0.099	0.114	1gncA.pdb.gz
17	PDB:1rhgB	0.395	0.507	1.448E-1	144	0.094	0.132	1rhgB.pdb.gz
18	PDB:1cnt2	0.406	0.580	1.830E-1	130	0.114	0.177	1cnt2.pdb.gz
19	PDB:1rw5A	0.531	0.538	2.106E-1	199	0.099	0.101	1rw5A.pdb.gz
20	PDB:1f6fA	0.347	0.369	3.209E-1	183	0.119	0.131	1f6fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15018	1.66e-149	414	202	1.000	1.000	LIF_HUMAN Leukemia inhibitory factor OS=Homo sapiens OX=9606 GN=LIF PE=1 SV=1
2	P17777	1.41e-125	354	202	0.827	0.827	LIF_RAT Leukemia inhibitory factor OS=Rattus norvegicus OX=10116 GN=Lif PE=2 SV=1
3	P09056	2.61e-120	341	203	0.802	0.798	LIF_MOUSE Leukemia inhibitory factor OS=Mus musculus OX=10090 GN=Lif PE=1 SV=1
4	O14185	1.6	31.2	174	0.074	0.086	STG1_SCHPO Transgelin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stg1 PE=4 SV=1
5	Q99741	3.8	30.8	560	0.099	0.036	CDC6_HUMAN Cell division control protein 6 homolog OS=Homo sapiens OX=9606 GN=CDC6 PE=1 SV=1
6	P0DQD2	7.5	30.0	630	0.119	0.038	INLB_LISMO Internalin B OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=inlB PE=1 SV=1
7	Q92090	9.0	29.6	504	0.124	0.050	CP2K1_ONCMY Cytochrome P450 2K1 OS=Oncorhynchus mykiss OX=8022 GN=cyp2k1 PE=2 SV=1
8	P01903	9.4	29.3	254	0.059	0.047	DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain OS=Homo sapiens OX=9606 GN=HLA-DRA PE=1 SV=2
9	Q12480	9.8	29.3	344	0.193	0.113	ETFA_YEAST Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIM45 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01291 LIF_OSM	1.9e-58	208.7	LIF / OSM family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004251

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000024471	0.995	Interleukin 6 signal transducer
2	61853.ENSNLEP00000024340	0.963	Uncharacterized protein
3	61853.ENSNLEP00000019831	0.879	Oncostatin M receptor
4	61853.ENSNLEP00000019466	0.864	Cardiotrophin 1
5	61853.ENSNLEP00000011506	0.861	Fibroblast growth factor 2 (basic)
6	61853.ENSNLEP00000014018	0.828	Signal transducer and activator of transcription 3 (acute-phase response factor)
7	61853.ENSNLEP00000024172	0.825	annotation not available
8	61853.ENSNLEP00000024378	0.825	Uncharacterized protein
9	61853.ENSNLEP00000005935	0.814	Ciliary neurotrophic factor receptor
10	61853.ENSNLEP00000018469	0.811	Leptin receptor
11	61853.ENSNLEP00000014009	0.809	Colony stimulating factor 3 receptor (granulocyte)
12	61853.ENSNLEP00000020374	0.808	Interleukin 6
13	61853.ENSNLEP00000004261	0.806	Oncostatin M
14	61853.ENSNLEP00000007775	0.782	Insulin-like growth factor 1 (somatomedin C)
15	61853.ENSNLEP00000001776	0.763	Colony stimulating factor 3 (granulocyte)
16	61853.ENSNLEP00000004657	0.744	Uncharacterized protein
17	61853.ENSNLEP00000002245	0.742	Interleukin-1
18	61853.ENSNLEP00000002277	0.739	Multifunctional fusion protein
19	61853.ENSNLEP00000023996	0.739	Hepatocyte growth factor (hepapoietin A
20	61853.ENSNLEP00000007426	0.733	Belongs to the tumor necrosis factor family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005126	1.000	cytokine receptor binding
GO:0008083	1.000	growth factor activity
GO:0005125	1.000	cytokine activity
GO:0005146	0.940	leukemia inhibitory factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.986	positive regulation of biological process
GO:0048522	0.984	positive regulation of cellular process
GO:0050896	0.983	response to stimulus
GO:0032501	0.983	multicellular organismal process
GO:0009987	0.980	cellular process
GO:0048856	0.978	anatomical structure development
GO:0010468	0.978	regulation of gene expression
GO:0007165	0.966	signal transduction
GO:0048523	0.965	negative regulation of cellular process
GO:0051171	0.949	regulation of nitrogen compound metabolic process
GO:0042127	0.949	regulation of cell population proliferation
GO:0010646	0.943	regulation of cell communication
GO:0048583	0.940	regulation of response to stimulus
GO:0007166	0.940	cell surface receptor signaling pathway
GO:0051173	0.939	positive regulation of nitrogen compound metabolic process
GO:0080090	0.938	regulation of primary metabolic process
GO:0023051	0.936	regulation of signaling
GO:0031323	0.936	regulation of cellular metabolic process
GO:0008284	0.931	positive regulation of cell population proliferation
GO:0023056	0.925	positive regulation of signaling
GO:0010604	0.925	positive regulation of macromolecule metabolic process
GO:0010647	0.924	positive regulation of cell communication
GO:0031325	0.920	positive regulation of cellular metabolic process
GO:0051240	0.915	positive regulation of multicellular organismal process
GO:0050793	0.911	regulation of developmental process
GO:0009966	0.909	regulation of signal transduction
GO:0032879	0.900	regulation of localization
GO:0009891	0.885	positive regulation of biosynthetic process
GO:0031328	0.882	positive regulation of cellular biosynthetic process
GO:1902531	0.880	regulation of intracellular signal transduction
GO:0051094	0.879	positive regulation of developmental process
GO:0045595	0.874	regulation of cell differentiation
GO:0001934	0.871	positive regulation of protein phosphorylation
GO:0019219	0.869	regulation of nucleobase-containing compound metabolic process
GO:0050731	0.860	positive regulation of peptidyl-tyrosine phosphorylation
GO:0006355	0.858	regulation of DNA-templated transcription
GO:1902533	0.857	positive regulation of intracellular signal transduction
GO:0045597	0.855	positive regulation of cell differentiation
GO:0007275	0.852	multicellular organism development
GO:0043408	0.841	regulation of MAPK cascade
GO:0060284	0.833	regulation of cell development
GO:0046883	0.829	regulation of hormone secretion
GO:2000026	0.817	regulation of multicellular organismal development
GO:0010557	0.801	positive regulation of macromolecule biosynthetic process
GO:0045935	0.799	positive regulation of nucleobase-containing compound metabolic process
GO:0030154	0.795	cell differentiation
GO:0045893	0.794	positive regulation of DNA-templated transcription
GO:0045944	0.701	positive regulation of transcription by RNA polymerase II
GO:0048731	0.664	system development
GO:0010720	0.622	positive regulation of cell development
GO:0002684	0.601	positive regulation of immune system process
GO:0042221	0.597	response to chemical
GO:0043410	0.483	positive regulation of MAPK cascade
GO:0048513	0.466	animal organ development
GO:0022603	0.456	regulation of anatomical structure morphogenesis
GO:0070887	0.386	cellular response to chemical stimulus
GO:0023057	0.374	negative regulation of signaling
GO:0010648	0.374	negative regulation of cell communication
GO:0010033	0.368	response to organic substance
GO:0048468	0.368	cell development
GO:0006950	0.348	response to stress
GO:0071310	0.335	cellular response to organic substance
GO:0071704	0.327	organic substance metabolic process
GO:0051128	0.324	regulation of cellular component organization
GO:0010628	0.312	positive regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005622	0.988	intracellular anatomical structure
GO:0005829	0.979	cytosol
GO:0043231	0.736	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]