StarFunc result for job id P15144

User Input

>input (967 residues)
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPA
SATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVI
IIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDS
EFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHP
KDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI
RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLV
TYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYL
GADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKG
ASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIM
NRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY
WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQ
IINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKN
YLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWM
ENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWI
LNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN
LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQ
WFTENSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5lhdC	0.916	0.978	0.000	905	0.936	1.000	5lhdC.pdb.gz	Allosteric inhibition of aminopeptidase N functions related to tumor growth and virus infection.
2	AFDB:P15541	0.980	0.981	0.000	966	0.794	0.795	P15541.pdb.gz	AMPN_RABIT Aminopeptidase N OS=Oryctolagus cuniculus OX=9986 GN=ANPEP PE=1 SV=4
3	AFDB:P15684	0.985	0.987	0.000	965	0.778	0.779	P15684.pdb.gz	AMPN_RAT Aminopeptidase N OS=Rattus norvegicus OX=10116 GN=Anpep PE=1 SV=2
4	AFDB:P97449	0.975	0.976	0.000	966	0.762	0.763	P97449.pdb.gz	AMPN_MOUSE Aminopeptidase N OS=Mus musculus OX=10090 GN=Anpep PE=1 SV=4
5	AFDB:Q59E93	0.960	0.950	0.000	977	0.998	0.988	Q59E93.pdb.gz	Q59E93_HUMAN Aminopeptidase (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
6	AFDB:Q10836	0.881	0.832	2.006E-76	1025	0.333	0.314	Q10836.pdb.gz	TRHDE_RAT Thyrotropin-releasing hormone-degrading ectoenzyme OS=Rattus norvegicus OX=10116 GN=Trhde PE=1 SV=1
7	AFDB:P50123	0.874	0.894	4.919E-75	945	0.353	0.361	P50123.pdb.gz	AMPE_RAT Glutamyl aminopeptidase OS=Rattus norvegicus OX=10116 GN=Enpep PE=1 SV=2
8	AFDB:Q9VFX0	0.866	0.843	9.175E-75	994	0.361	0.351	Q9VFX0.pdb.gz	Q9VFX0_DROME Aminopeptidase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8773 PE=1 SV=2
9	AFDB:B0BCY7	0.875	0.884	1.039E-74	957	0.336	0.340	B0BCY7.pdb.gz	B0BCY7_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
10	AFDB:P16406	0.875	0.895	5.952E-74	945	0.346	0.354	P16406.pdb.gz	AMPE_MOUSE Glutamyl aminopeptidase OS=Mus musculus OX=10090 GN=Enpep PE=1 SV=1
11	AFDB:Q6Q4G3	0.793	0.776	1.065E-73	990	0.354	0.345	Q6Q4G3.pdb.gz	AMPQ_HUMAN Aminopeptidase Q OS=Homo sapiens OX=9606 GN=LVRN PE=1 SV=4
12	PDB:4kx7A	0.863	0.952	1.195E-71	875	0.325	0.359	4kx7A.pdb.gz	Structural insights into central hypertension regulation by human aminopeptidase a.
13	PDB:6rqxA	0.835	0.934	1.836E-67	862	0.304	0.341	6rqxA.pdb.gz	Mechanism for antigenic peptide selection by endoplasmic reticulum aminopeptidase 1.
14	PDB:7pfsA	0.835	0.880	2.642E-64	916	0.305	0.322	7pfsA.pdb.gz	Inhibitor-Dependent Usage of the S1' Specificity Pocket of ER Aminopeptidase 2.
15	PDB:7nupD	0.848	0.926	4.927E-64	884	0.310	0.339	7nupD.pdb.gz	Endoplasmic reticulum aminopeptidase 2 complexed with a mixed hydroxamic and sulfonyl ligand
16	PDB:4wz9B	0.783	0.850	7.038E-63	887	0.291	0.317	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.
17	PDB:5k1vB	0.827	0.939	2.365E-60	849	0.310	0.353	5k1vB.pdb.gz	Crystal Structures of ERAP2 Complexed with Inhibitors Reveal Pharmacophore Requirements for Optimizing Inhibitor Potency.
18	PDB:3mdjC	0.686	0.795	8.488E-57	819	0.286	0.338	3mdjC.pdb.gz	Structural basis for antigenic peptide precursor processing by the endoplasmic reticulum aminopeptidase ERAP1.
19	PDB:4xo4A	0.639	0.704	3.794E-32	870	0.161	0.179	4xo4A.pdb.gz	Crystal Structure of E. coli Aminopeptidase N in complex with L-Methionine
20	PDB:3b7rL	0.424	0.645	5.812E-23	610	0.123	0.195	3b7rL.pdb.gz	Structure-based dissection of the active site chemistry of leukotriene a4 hydrolase: implications for m1 aminopeptidases and inhibitor design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	B0BCY7	554	957	0.342	0.346	B0BCY7_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
2	B0BCY8	554	957	0.342	0.346	B0BCY8_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
3	B0BCY9	563	957	0.344	0.348	B0BCY9_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
4	B0BCZ0	554	957	0.342	0.346	B0BCZ0_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
5	B0BCZ1	555	957	0.343	0.347	B0BCZ1_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
6	B0BCZ2	555	957	0.343	0.347	B0BCZ2_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
7	B0BCZ3	552	957	0.341	0.345	B0BCZ3_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
8	B0BCZ4	552	957	0.341	0.345	B0BCZ4_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
9	B0BCZ5	553	957	0.342	0.346	B0BCZ5_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
10	B0BCZ6	553	957	0.342	0.346	B0BCZ6_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
11	B0BCZ7	553	957	0.341	0.345	B0BCZ7_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
12	B2R8K9	554	957	0.342	0.346	B2R8K9_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 PE=2 SV=1
13	B4DP01	1105	533	0.550	0.998	B4DP01_HUMAN cDNA FLJ56120, highly similar to Aminopeptidase N OS=Homo sapiens OX=9606 PE=2 SV=1
14	B4DP96	1005	482	0.498	1.000	B4DP96_HUMAN cDNA FLJ51269, highly similar to Aminopeptidase N OS=Homo sapiens OX=9606 PE=2 SV=1
15	B4DPH5	1106	533	0.550	0.998	B4DPH5_HUMAN cDNA FLJ55496, highly similar to Aminopeptidase N OS=Homo sapiens OX=9606 PE=2 SV=1
16	B4DV63	1276	614	0.635	1.000	B4DV63_HUMAN cDNA FLJ56158, highly similar to Aminopeptidase N OS=Homo sapiens OX=9606 PE=2 SV=1
17	P15144	2009	967	1.000	1.000	AMPN_HUMAN Aminopeptidase N OS=Homo sapiens OX=9606 GN=ANPEP PE=1 SV=4
18	P15541	1617	966	0.800	0.801	AMPN_RABIT Aminopeptidase N OS=Oryctolagus cuniculus OX=9986 GN=ANPEP PE=1 SV=4
19	P15684	1570	965	0.779	0.780	AMPN_RAT Aminopeptidase N OS=Rattus norvegicus OX=10116 GN=Anpep PE=1 SV=2
20	P16406	577	945	0.353	0.361	AMPE_MOUSE Glutamyl aminopeptidase OS=Mus musculus OX=10090 GN=Enpep PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10023 Aminopep	69	14.3	Putative aminopeptidase
2	PF04450 BSP	3.2e+02	12.5	Peptidase of plants and bacteria
3	PF18958 DUF5700	67	14.3	Putative zinc dependent peptidase (DUF5700)
4	PF11838 ERAP1_C	5e-87	303.9	ERAP1-like C-terminal domain
5	PF16954 HRG	3.1e+02	13.2	Haem-transporter, endosomal/lysosomal, haem-responsive gene
6	PF12704 MacB_PCD	3.2e+02	13.0	MacB-like periplasmic core domain
7	PF01433 Peptidase_M1	6.8e-83	289.1	Peptidase family M1 domain
8	PF17900 Peptidase_M1_N	3.6e-55	198.5	Peptidase M1 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300060

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000043402	0.989	Reticulon-4 receptor
2	9606.ENSP00000340989	0.977	14-3-3 protein sigma
3	9606.ENSP00000254301	0.969	Galectin-3
4	9606.ENSP00000226299	0.957	Cytosol aminopeptidase
5	9606.ENSP00000370962	0.947	Glutathione hydrolase 6
6	9606.ENSP00000338964	0.946	Glutathione hydrolase 7
7	9606.ENSP00000381340	0.945	Glutathione hydrolase 5 proenzyme
8	9606.ENSP00000386896	0.944	Integrin alpha-6
9	9606.ENSP00000383232	0.941	Glutathione hydrolase 1 proenzyme
10	9606.ENSP00000272425	0.936	N-acetyltransferase 8
11	9606.ENSP00000229416	0.934	Glutamate-cysteine ligase catalytic subunit
12	9606.ENSP00000355627	0.922	Angiotensinogen
13	9606.ENSP00000359258	0.908	Glutamate-cysteine ligase modifier subunit
14	9606.ENSP00000216951	0.907	Glutathione synthetase
15	9606.ENSP00000262262	0.905	Myeloid cell surface antigen CD33
16	9606.ENSP00000275428	0.902	Gamma-glutamylcyclotransferase
17	9606.ENSP00000295304	0.902	Glutathione-specific gamma-glutamylcyclotransferase 2
18	9606.ENSP00000398105	0.902	Glutathione-specific gamma-glutamylcyclotransferase 1
19	9606.ENSP00000418525	0.901	Neprilysin
20	9606.ENSP00000310036	0.869	Hematopoietic progenitor cell antigen CD34

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008237	1.000	metallopeptidase activity
GO:0004177	1.000	aminopeptidase activity
GO:0005488	0.995	binding
GO:0005515	0.915	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.980	biological regulation
GO:1901564	0.978	organonitrogen compound metabolic process
GO:0006508	0.939	proteolysis
GO:0043603	0.936	amide metabolic process
GO:0050789	0.909	regulation of biological process
GO:0006518	0.880	peptide metabolic process
GO:0044237	0.879	cellular metabolic process
GO:0009056	0.836	catabolic process
GO:0043171	0.728	peptide catabolic process
GO:0051604	0.631	protein maturation
GO:0050794	0.609	regulation of cellular process
GO:0050896	0.524	response to stimulus
GO:0032501	0.506	multicellular organismal process
GO:0051239	0.447	regulation of multicellular organismal process
GO:0048519	0.391	negative regulation of biological process
GO:0032502	0.357	developmental process
GO:0048856	0.332	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.948	membrane-bounded organelle
GO:0005622	0.947	intracellular anatomical structure
GO:0005737	0.912	cytoplasm
GO:0005615	0.880	extracellular space
GO:0043229	0.864	intracellular organelle
GO:0043231	0.831	intracellular membrane-bounded organelle
GO:0031090	0.827	organelle membrane
GO:0031982	0.804	vesicle
GO:0000323	0.625	lytic vacuole
GO:0098588	0.585	bounding membrane of organelle
GO:0005764	0.579	lysosome
GO:0009986	0.417	cell surface
GO:0005774	0.304	vacuolar membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.11.-	1.000	Aminopeptidases.

[back to server]