StarFunc result for job id P15151

User Input

>input (417 residues)
MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTH
VSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGN
YTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWH
SDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTV
YYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIR
PVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNAIIFLVLGILVFLILLG
IGIYFYWSKCSREVLWHCHLCPSSTEHASASANGHVSYSAVSRENSSSQDPQTEGTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15151	1.000	1.000	1.977E-72	417	1.000	1.000	P15151.pdb.gz	PVR_HUMAN Poliovirus receptor OS=Homo sapiens OX=9606 GN=PVR PE=1 SV=2
2	AFDB:P32507	0.713	0.565	7.093E-43	530	0.472	0.372	P32507.pdb.gz	NECT2_MOUSE Nectin-2 OS=Mus musculus OX=10090 GN=Nectin2 PE=1 SV=2
3	AFDB:Q92692	0.722	0.564	1.335E-41	538	0.465	0.361	Q92692.pdb.gz	NECT2_HUMAN Nectin-2 OS=Homo sapiens OX=9606 GN=NECTIN2 PE=1 SV=1
4	AFDB:Q5U334	0.654	0.661	8.943E-39	412	0.396	0.400	Q5U334.pdb.gz
5	AFDB:Q60977	0.631	0.634	6.028E-38	415	0.393	0.395	Q60977.pdb.gz	Q60977_MOUSE Tumor-associated glycoprotein E4 OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
6	AFDB:Q8BVF6	0.598	0.610	5.188E-37	408	0.398	0.407	Q8BVF6.pdb.gz	Q8BVF6_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
7	AFDB:Q15223	0.636	0.522	1.067E-32	517	0.295	0.238	Q15223.pdb.gz	NECT1_HUMAN Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3
8	AFDB:B0CLW6	0.651	0.814	4.862E-32	328	0.261	0.332	B0CLW6.pdb.gz	B0CLW6_DANRE PVR cell adhesion molecule related 2 like precursor OS=Danio rerio OX=7955 GN=si:dkey-225e11.1 PE=1 SV=1
9	AFDB:Q9JLB9	0.640	0.497	2.686E-30	549	0.276	0.209	Q9JLB9.pdb.gz	NECT3_MOUSE Nectin-3 OS=Mus musculus OX=10090 GN=Nectin3 PE=1 SV=1
10	AFDB:K4PZ75	0.615	0.513	3.960E-29	510	0.281	0.229	K4PZ75.pdb.gz	K4PZ75_HUMAN Ig superfamily receptor LNIR OS=Homo sapiens OX=9606 GN=LNIR PE=2 SV=1
11	PDB:6dldD	0.437	0.630	1.734E-12	269	0.132	0.204	6dldD.pdb.gz
12	PDB:6dlfA	0.428	0.706	5.609E-12	236	0.125	0.220	6dlfA.pdb.gz
13	PDB:5oj2B	0.252	0.169	9.577E-11	692	0.151	0.091	5oj2B.pdb.gz
14	PDB:1igaA	0.228	0.204	8.657E-10	475	0.153	0.135	1igaA.pdb.gz
15	PDB:1igtB	0.243	0.232	2.941E-9	444	0.132	0.124	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
16	PDB:1zvoC	0.209	0.176	5.556E-9	512	0.120	0.098	1zvoC.pdb.gz
17	PDB:2rcjC	0.244	0.207	6.127E-9	523	0.141	0.113	2rcjC.pdb.gz
18	PDB:1e07A	0.232	0.167	8.217E-9	642	0.139	0.090	1e07A.pdb.gz
19	PDB:1hzhH	0.266	0.249	1.102E-8	457	0.146	0.133	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
20	PDB:5c7kF	0.236	0.405	1.215E-8	212	0.101	0.198	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15151	0.0	858	417	1.000	1.000	PVR_HUMAN Poliovirus receptor OS=Homo sapiens OX=9606 GN=PVR PE=1 SV=2
2	P32507	2.42e-109	333	530	0.420	0.330	NECT2_MOUSE Nectin-2 OS=Mus musculus OX=10090 GN=Nectin2 PE=1 SV=2
3	Q92692	1.43e-105	324	538	0.412	0.320	NECT2_HUMAN Nectin-2 OS=Homo sapiens OX=9606 GN=NECTIN2 PE=1 SV=1
4	Q60977	1.15e-87	274	415	0.362	0.364	Q60977_MOUSE Tumor-associated glycoprotein E4 OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
5	Q91WP1	3.34e-87	273	408	0.388	0.397	Q91WP1_MOUSE Cd155 OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
6	Q8K094	1.59e-86	271	408	0.386	0.395	Q8K094_MOUSE Poliovirus receptor OS=Mus musculus OX=10090 GN=Pvr PE=1 SV=1
7	Q8BVF6	3.81e-86	270	408	0.384	0.392	Q8BVF6_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
8	B0CLW6	4.99e-56	189	328	0.252	0.320	B0CLW6_DANRE PVR cell adhesion molecule related 2 like precursor OS=Danio rerio OX=7955 GN=si:dkey-225e11.1 PE=1 SV=1
9	Q9JKF6	2.67e-54	190	515	0.324	0.262	NECT1_MOUSE Nectin-1 OS=Mus musculus OX=10090 GN=Nectin1 PE=1 SV=3
10	A0A8I5ZLI7	6.69e-54	187	447	0.297	0.277	A0A8I5ZLI7_RAT Nectin cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Nectin1 PE=1 SV=1
11	F1LNP8	2.18e-53	187	515	0.321	0.260	F1LNP8_RAT Nectin cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Nectin1 PE=1 SV=2
12	Q9GL76	7.62e-51	181	515	0.317	0.256	NECT1_PIG Nectin-1 OS=Sus scrofa OX=9823 GN=NECTIN1 PE=1 SV=1
13	Q15223	6.83e-49	175	517	0.302	0.244	NECT1_HUMAN Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3
14	A0A8I6APZ5	1.02e-39	149	438	0.237	0.226	A0A8I6APZ5_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=3 SV=1
15	D4A5C0	1.26e-36	142	528	0.221	0.174	D4A5C0_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=1 SV=2
16	A0A8I5ZU75	1.71e-36	142	549	0.223	0.169	A0A8I5ZU75_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=3 SV=1
17	Q9NQS3	4.12e-36	141	549	0.218	0.166	NECT3_HUMAN Nectin-3 OS=Homo sapiens OX=9606 GN=NECTIN3 PE=1 SV=1
18	Q9JLB9	1.15e-35	140	549	0.221	0.168	NECT3_MOUSE Nectin-3 OS=Mus musculus OX=10090 GN=Nectin3 PE=1 SV=1
19	K4PZ75	5.93e-27	114	510	0.218	0.178	K4PZ75_HUMAN Ig superfamily receptor LNIR OS=Homo sapiens OX=9606 GN=LNIR PE=2 SV=1
20	Q96NY8	5.93e-27	114	510	0.218	0.178	NECT4_HUMAN Nectin-4 OS=Homo sapiens OX=9606 GN=NECTIN4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	1.5e+02	14.1	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	1.2e-18	78.3	CD80-like C2-set immunoglobulin domain
3	PF06365 CD34_antigen	2.8e+02	12.5	CD34/Podocalyxin family
4	PF07679 I-set	0.0027	29.1	Immunoglobulin I-set domain
5	PF00047 ig	2.9e-10	51.5	Immunoglobulin domain
6	PF13895 Ig_2	0.0021	29.7	Immunoglobulin domain
7	PF13927 Ig_3	7.3e-11	53.8	Immunoglobulin domain
8	PF07686 V-set	6.6e-08	44.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000402060

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280200	0.999	CD226 antigen
2	9606.ENSP00000283285	0.999	T-cell surface protein tactile
3	9606.ENSP00000419085	0.999	T-cell immunoreceptor with Ig and ITIM domains
4	9606.ENSP00000375960	0.975	Afadin
5	9606.ENSP00000418070	0.975	Nectin-3
6	9606.ENSP00000356056	0.974	Dynein light chain Tctex-type 1
7	9606.ENSP00000264025	0.971	Nectin-1
8	9606.ENSP00000226218	0.939	Vitronectin
9	9606.ENSP00000362680	0.926	Proto-oncogene tyrosine-protein kinase Src
10	9606.ENSP00000261023	0.911	Integrin alpha-V
11	9606.ENSP00000452786	0.906	Integrin beta-3
12	9606.ENSP00000240618	0.822	Killer cell lectin-like receptor subfamily K, member 1
13	9606.ENSP00000316675	0.732	Transmembrane protein PVRIG
14	9606.ENSP00000356308	0.718	UL16-binding protein 3
15	9606.ENSP00000356320	0.717	UL16-binding protein 2
16	9606.ENSP00000480609	0.711	annotation not available
17	9606.ENSP00000229708	0.710	UL16-binding protein 1
18	9606.ENSP00000413079	0.705	MHC class I polypeptide-related sequence A
19	9606.ENSP00000320084	0.690	CD276 antigen
20	9606.ENSP00000357036	0.689	SLAM family member 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060089	0.999	molecular transducer activity
GO:0038023	0.968	signaling receptor activity
GO:0050839	0.951	cell adhesion molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0009987	0.919	cellular process
GO:0048522	0.917	positive regulation of cellular process
GO:0031341	0.902	regulation of cell killing
GO:0002703	0.901	regulation of leukocyte mediated immunity
GO:0045088	0.886	regulation of innate immune response
GO:0050778	0.877	positive regulation of immune response
GO:0002699	0.870	positive regulation of immune effector process
GO:0042269	0.857	regulation of natural killer cell mediated cytotoxicity
GO:0002833	0.847	positive regulation of response to biotic stimulus
GO:0002708	0.846	positive regulation of lymphocyte mediated immunity
GO:0031343	0.841	positive regulation of cell killing
GO:0002717	0.840	positive regulation of natural killer cell mediated immunity
GO:0045954	0.756	positive regulation of natural killer cell mediated cytotoxicity
GO:0002819	0.747	regulation of adaptive immune response
GO:0002822	0.706	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002824	0.681	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002709	0.654	regulation of T cell mediated immunity
GO:0050896	0.653	response to stimulus
GO:0002711	0.627	positive regulation of T cell mediated immunity
GO:0001914	0.545	regulation of T cell mediated cytotoxicity
GO:0051239	0.382	regulation of multicellular organismal process
GO:0032501	0.313	multicellular organismal process
GO:0002376	0.303	immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.967	extracellular region
GO:0005737	0.960	cytoplasm
GO:0030054	0.956	cell junction
GO:0005615	0.876	extracellular space
GO:0070161	0.872	anchoring junction
GO:0009986	0.846	cell surface
GO:0043227	0.805	membrane-bounded organelle
GO:0031982	0.622	vesicle
GO:0070062	0.492	extracellular exosome
GO:0030055	0.475	cell-substrate junction
GO:0005925	0.413	focal adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]