StarFunc result for job id P15170

User Input

>input (499 residues)
MELSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKP
KSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRET
WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAV
LVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEK
LVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDG
PIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGE
NLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCI
EEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLR
DEGKTIAIGKVLKLVPEKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IYD1	0.864	0.687	7.530E-95	628	0.938	0.745	Q8IYD1.pdb.gz	ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens OX=9606 GN=GSPT2 PE=1 SV=2
2	AFDB:Q91855	0.887	0.722	1.655E-94	614	0.922	0.749	Q91855.pdb.gz	Q91855_XENLA SUP35 protein (Fragment) OS=Xenopus laevis OX=8355 GN=SUP35 PE=1 SV=1
3	AFDB:Q7T358	0.893	0.773	2.942E-90	577	0.860	0.744	Q7T358.pdb.gz	Q7T358_DANRE G1 to S phase transition 1 OS=Danio rerio OX=7955 GN=gspt1 PE=1 SV=1
4	AFDB:P91944	0.856	0.691	2.726E-79	619	0.663	0.535	P91944.pdb.gz	P91944_DROME Elongation factor 1 alpha-like factor OS=Drosophila melanogaster OX=7227 GN=eRF3 PE=2 SV=1
5	PDB:5lztjj	0.840	0.978	4.574E-78	428	0.858	1.000	5lztjj.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
6	AFDB:P05453	0.844	0.616	2.113E-71	685	0.517	0.377	P05453.pdb.gz	ERF3_YEAST Eukaryotic peptide chain release factor GTP-binding subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUP35 PE=1 SV=1
7	AFDB:Q59YE8	0.843	0.585	6.506E-71	721	0.513	0.355	Q59YE8.pdb.gz	Q59YE8_CANAL Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUP35 PE=3 SV=1
8	AFDB:O74718	0.840	0.634	2.817E-69	662	0.481	0.363	O74718.pdb.gz	ERF3_SCHPO Eukaryotic peptide chain release factor GTP-binding subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sup35 PE=1 SV=2
9	AFDB:Q9LMS7	0.852	0.784	6.549E-69	543	0.529	0.486	Q9LMS7.pdb.gz	Q9LMS7_ARATH T10F20.8 protein OS=Arabidopsis thaliana OX=3702 GN=At1g18070 PE=1 SV=1
10	AFDB:D9YZV0	0.831	0.608	3.818E-62	684	0.399	0.291	D9YZV0.pdb.gz	D9YZV0_HUMAN HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L PE=1 SV=1
11	AFDB:Q69ZS7	0.831	0.611	1.473E-61	682	0.385	0.282	Q69ZS7.pdb.gz	HBS1L_MOUSE HBS1-like protein OS=Mus musculus OX=10090 GN=Hbs1l PE=1 SV=2
12	PDB:6ji2A	0.832	0.959	1.154E-52	432	0.339	0.391	6ji2A.pdb.gz	Switch of the interactions between the ribosomal stalk and EF1A in the GTP- and GDP-bound conformations.
13	PDB:5lzwjj	0.815	0.954	1.158E-51	425	0.367	0.431	5lzwjj.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
14	PDB:5o8wA	0.661	0.724	2.312E-46	449	0.329	0.365	5o8wA.pdb.gz	Protein glutaminylation is a yeast-specific posttranslational modification of elongation factor 1A.
15	PDB:6ra9B	0.457	0.492	1.124E-43	458	0.325	0.354	6ra9B.pdb.gz	Structural Cues for Understanding eEF1A2 Moonlighting.
16	PDB:5m1jA6	0.759	0.705	4.166E-38	539	0.291	0.269	5m1jA6.pdb.gz	Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.
17	PDB:3mcaA	0.560	0.711	2.052E-31	377	0.234	0.310	3mcaA.pdb.gz
18	PDB:7a5gZ	0.662	0.829	5.338E-31	394	0.226	0.287	7a5gZ.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
19	PDB:1ob2A	0.648	0.812	9.909E-31	393	0.218	0.277	1ob2A.pdb.gz	Kirromycin Defines a Specific Domain Arrangement of Elongation Factor EF-TU
20	PDB:7paj9	0.665	0.834	1.660E-27	393	0.224	0.285	7paj9.pdb.gz	Visualizing translation dynamics at atomic detail inside a bacterial cell.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M9PD08	0.0	687	495	0.645	0.651	M9PD08_DROME Eukaryotic translation release factor 3, isoform C OS=Drosophila melanogaster OX=7227 GN=eRF3 PE=1 SV=1
2	P15170	0.0	1025	499	1.000	1.000	ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1 PE=1 SV=1
3	P91944	0.0	684	619	0.639	0.515	P91944_DROME Elongation factor 1 alpha-like factor OS=Drosophila melanogaster OX=7227 GN=eRF3 PE=2 SV=1
4	Q7T358	0.0	870	577	0.854	0.738	Q7T358_DANRE G1 to S phase transition 1 OS=Danio rerio OX=7955 GN=gspt1 PE=1 SV=1
5	Q8IYD1	0.0	942	628	0.938	0.745	ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens OX=9606 GN=GSPT2 PE=1 SV=2
6	Q91855	0.0	914	614	0.922	0.749	Q91855_XENLA SUP35 protein (Fragment) OS=Xenopus laevis OX=8355 GN=SUP35 PE=1 SV=1
7	Q9VK85	0.0	691	619	0.645	0.520	Q9VK85_DROME Eukaryotic translation release factor 3, isoform A OS=Drosophila melanogaster OX=7227 GN=eRF3 PE=1 SV=1
8	Q59YE8	1.74e-179	523	721	0.491	0.340	Q59YE8_CANAL Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUP35 PE=3 SV=1
9	Q9LMS7	1.90e-179	516	543	0.503	0.462	Q9LMS7_ARATH T10F20.8 protein OS=Arabidopsis thaliana OX=3702 GN=At1g18070 PE=1 SV=1
10	Q7LKB1	6.74e-176	512	685	0.491	0.358	Q7LKB1_YEASX Eukaryotic peptide chain release factor GTP-binding subunit OS=Saccharomyces cerevisiae OX=4932 GN=SUP35 PE=1 SV=1
11	P05453	8.56e-176	512	685	0.491	0.358	ERF3_YEAST Eukaryotic peptide chain release factor GTP-binding subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUP35 PE=1 SV=1
12	O74718	7.96e-169	493	662	0.463	0.349	ERF3_SCHPO Eukaryotic peptide chain release factor GTP-binding subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sup35 PE=1 SV=2
13	Q385F3	2.81e-129	393	698	0.409	0.292	Q385F3_TRYB2 Eukaryotic release factor 3, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4030 PE=4 SV=1
14	Q7YZN6	5.58e-124	370	426	0.389	0.455	Q7YZN6_9TRYP Eukaryotic release factor 3 (Fragment) OS=Trypanosoma brucei OX=5691 GN=erf3 PE=4 SV=1
15	D9YZV0	2.30e-113	352	684	0.369	0.269	D9YZV0_HUMAN HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L PE=1 SV=1
16	Q9Y450	2.30e-113	352	684	0.369	0.269	HBS1L_HUMAN HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L PE=1 SV=1
17	Q69ZS7	1.45e-108	339	682	0.363	0.265	HBS1L_MOUSE HBS1-like protein OS=Mus musculus OX=10090 GN=Hbs1l PE=1 SV=2
18	P0CY35	1.47e-107	329	458	0.357	0.389	EF1A1_CANAL Elongation factor 1-alpha 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TEF1 PE=3 SV=1
19	P0CT31	4.45e-107	328	453	0.343	0.377	EF1A1_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum OX=44689 GN=eef1a1 PE=1 SV=1
20	P0CT32	4.45e-107	328	453	0.343	0.377	EF1A2_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum OX=44689 GN=eef1a2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	1.8e+02	13.0	ADP-ribosylation factor family
2	PF00009 GTP_EFTU	1.2e-42	157.2	Elongation factor Tu GTP binding domain
3	PF03144 GTP_EFTU_D2	9.7e-05	34.0	Elongation factor Tu domain 2
4	PF03143 GTP_EFTU_D3	2.7e-21	87.2	Elongation factor Tu C-terminal domain
5	PF01926 MMR_HSR1	2	19.9	50S ribosome-binding GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000012432

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010967	0.999	Eukaryotic translation termination factor 1
2	61853.ENSNLEP00000007351	0.993	UPF1, RNA helicase and ATPase
3	61853.ENSNLEP00000004513	0.978	Eukaryotic translation elongation factor 1 gamma
4	61853.ENSNLEP00000003888	0.953	Polyadenylate-binding protein
5	61853.ENSNLEP00000004021	0.905	Cereblon
6	61853.ENSNLEP00000006642	0.897	Belongs to the PI3/PI4-kinase family.
7	61853.ENSNLEP00000010757	0.897	Uncharacterized protein
8	61853.ENSNLEP00000018700	0.893	Ribosomal protein S7
9	61853.ENSNLEP00000013226	0.888	Protein pelota homolog
10	61853.ENSNLEP00000019921	0.885	Zinc finger, GRF-type containing 1
11	61853.ENSNLEP00000013384	0.881	Ribosomal protein L8
12	61853.ENSNLEP00000003630	0.875	annotation not available
13	61853.ENSNLEP00000007738	0.872	valyl-tRNA synthetase
14	61853.ENSNLEP00000012240	0.864	Uncharacterized protein
15	61853.ENSNLEP00000006640	0.863	ATP-binding cassette, sub-family E (OABP), member 1
16	61853.ENSNLEP00000021027	0.862	methionyl-tRNA synthetase
17	61853.ENSNLEP00000014528	0.860	Polyadenylate-binding protein
18	61853.ENSNLEP00000020219	0.859	Eukaryotic translation initiation factor 3 subunit A
19	61853.ENSNLEP00000017139	0.853	glutamyl-prolyl-tRNA synthetase
20	61853.ENSNLEP00000006813	0.844	40S ribosomal protein SA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0045182	0.999	translation regulator activity
GO:0003824	0.995	catalytic activity
GO:0016818	0.988	hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0090079	0.985	translation regulator activity, nucleic acid binding
GO:0008135	0.984	translation factor activity, RNA binding
GO:0016462	0.947	pyrophosphatase activity
GO:0017111	0.937	ribonucleoside triphosphate phosphatase activity
GO:0003924	0.878	GTPase activity
GO:0008079	0.805	translation termination factor activity
GO:0003747	0.789	translation release factor activity
GO:0032555	0.655	purine ribonucleotide binding
GO:0043168	0.621	anion binding
GO:0035639	0.600	purine ribonucleoside triphosphate binding
GO:0032561	0.533	guanyl ribonucleotide binding
GO:0005525	0.354	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044260	0.989	cellular macromolecule metabolic process
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:1901564	0.981	organonitrogen compound metabolic process
GO:0019538	0.974	protein metabolic process
GO:0043603	0.969	amide metabolic process
GO:0010467	0.969	gene expression
GO:0009058	0.959	biosynthetic process
GO:0006518	0.959	peptide metabolic process
GO:0006412	0.946	translation
GO:0071840	0.746	cellular component organization or biogenesis
GO:0016043	0.669	cellular component organization
GO:0022411	0.650	cellular component disassembly
GO:0032984	0.501	protein-containing complex disassembly
GO:0065007	0.498	biological regulation
GO:0050789	0.490	regulation of biological process
GO:0050794	0.406	regulation of cellular process
GO:0019222	0.387	regulation of metabolic process
GO:0060255	0.361	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0032991	0.995	protein-containing complex
GO:0043226	0.764	organelle
GO:0043229	0.720	intracellular organelle
GO:0043227	0.684	membrane-bounded organelle
GO:0043231	0.628	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.988	In phosphorus-containing anhydrides.
RHEA:23680	0.937	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.937	nucleoside-triphosphate phosphatase.
RHEA:19669	0.878	GTP + H2O = GDP + H(+) + phosphate

[back to server]