StarFunc result for job id P15172

User Input

>input (320 residues)
MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPE
EHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERR
RLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYA
PGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRP
GKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQS
PDAAPQCPAGANPNPIYQVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15172	0.999	0.999	3.138E-48	320	1.000	1.000	P15172.pdb.gz	MYOD1_HUMAN Myoblast determination protein 1 OS=Homo sapiens OX=9606 GN=MYOD1 PE=1 SV=3
2	AFDB:P10085	0.465	0.468	5.453E-41	318	0.878	0.884	P10085.pdb.gz	MYOD1_MOUSE Myoblast determination protein 1 OS=Mus musculus OX=10090 GN=Myod1 PE=1 SV=2
3	AFDB:P16075	0.341	0.363	5.537E-27	298	0.625	0.671	P16075.pdb.gz	MYOD1_CHICK Myoblast determination protein 1 homolog OS=Gallus gallus OX=9031 GN=MYOD1 PE=2 SV=2
4	AFDB:Q90477	0.324	0.374	1.766E-25	275	0.588	0.684	Q90477.pdb.gz	MYOD1_DANRE Myoblast determination protein 1 homolog OS=Danio rerio OX=7955 GN=myod1 PE=1 SV=2
5	AFDB:Q08856	0.267	0.326	9.233E-16	258	0.447	0.554	Q08856.pdb.gz	MYF5_CHICK Myogenic factor 5 OS=Gallus gallus OX=9031 GN=MYF5 PE=3 SV=2
6	AFDB:P13349	0.249	0.307	2.278E-14	255	0.422	0.529	P13349.pdb.gz	MYF5_HUMAN Myogenic factor 5 OS=Homo sapiens OX=9606 GN=MYF5 PE=1 SV=2
7	AFDB:P24699	0.245	0.303	2.278E-14	255	0.428	0.537	P24699.pdb.gz	MYF5_MOUSE Myogenic factor 5 OS=Mus musculus OX=10090 GN=Myf5 PE=1 SV=1
8	AFDB:Q5CZP8	0.255	0.337	2.620E-12	237	0.350	0.473	Q5CZP8.pdb.gz
9	AFDB:P12979	0.225	0.315	3.029E-9	224	0.284	0.406	P12979.pdb.gz	MYOG_MOUSE Myogenin OS=Mus musculus OX=10090 GN=Myog PE=1 SV=2
10	AFDB:Q01795	0.240	0.312	5.395E-9	242	0.312	0.413	Q01795.pdb.gz	MYF6_CHICK Myogenic factor 6 OS=Gallus gallus OX=9031 GN=MYF6 PE=2 SV=1
11	PDB:7dgqg	0.084	0.139	3.132	173	0.087	0.162	7dgqg.pdb.gz	A Dynamic Substrate Pool Revealed by cryo-EM of a Lipid-Preserved Respiratory Supercomplex.
12	PDB:6mdmH	0.072	0.152	3.561	147	0.066	0.143	6mdmH.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.
13	PDB:7mqaNA	0.099	0.107	3.797	295	0.066	0.071	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:2bskD	0.116	0.326	4.907	90	0.028	0.100	2bskD.pdb.gz
15	PDB:7wtxt	0.115	0.219	5.578	132	0.044	0.106	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
16	PDB:4v6wCC	0.086	0.071	6.761	392	0.056	0.046	4v6wCC.pdb.gz	Structures of the human and Drosophila 80S ribosome.
17	PDB:7c79B	0.100	0.049	6.761	793	0.059	0.024	7c79B.pdb.gz	Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.
18	PDB:6zx9C	0.081	0.096	7.209	257	0.050	0.062	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
19	PDB:6qx91K	0.090	0.132	7.686	201	0.053	0.085	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
20	PDB:7egdF	0.079	0.063	8.738	412	0.066	0.051	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10085	0.0	528	318	0.881	0.887	MYOD1_MOUSE Myoblast determination protein 1 OS=Mus musculus OX=10090 GN=Myod1 PE=1 SV=2
2	P15172	0.0	647	320	1.000	1.000	MYOD1_HUMAN Myoblast determination protein 1 OS=Homo sapiens OX=9606 GN=MYOD1 PE=1 SV=3
3	Q02346	0.0	546	318	0.872	0.877	MYOD1_RAT Myoblast determination protein 1 OS=Rattus norvegicus OX=10116 GN=Myod1 PE=1 SV=1
4	P16075	4.27e-131	377	298	0.637	0.685	MYOD1_CHICK Myoblast determination protein 1 homolog OS=Gallus gallus OX=9031 GN=MYOD1 PE=2 SV=2
5	P13904	3.69e-125	361	289	0.619	0.685	MYODA_XENLA Myoblast determination protein 1 homolog A OS=Xenopus laevis OX=8355 GN=myod1-a PE=2 SV=1
6	Q90477	3.27e-120	348	275	0.578	0.673	MYOD1_DANRE Myoblast determination protein 1 homolog OS=Danio rerio OX=7955 GN=myod1 PE=1 SV=2
7	P13349	8.55e-72	224	255	0.431	0.541	MYF5_HUMAN Myogenic factor 5 OS=Homo sapiens OX=9606 GN=MYF5 PE=1 SV=2
8	Q08856	2.19e-71	223	258	0.416	0.516	MYF5_CHICK Myogenic factor 5 OS=Gallus gallus OX=9031 GN=MYF5 PE=3 SV=2
9	P24699	4.74e-71	223	255	0.438	0.549	MYF5_MOUSE Myogenic factor 5 OS=Mus musculus OX=10090 GN=Myf5 PE=1 SV=1
10	Q9DDW0	2.20e-51	171	237	0.353	0.477	Q9DDW0_DANRE Myogenic factor OS=Danio rerio OX=7955 GN=myf-5 PE=2 SV=1
11	P22816	6.23e-37	136	332	0.287	0.277	MYOD_DROME Myogenic-determination protein OS=Drosophila melanogaster OX=7227 GN=nau PE=2 SV=3
12	P15375	2.53e-34	127	242	0.200	0.264	MYF6_MOUSE Myogenic factor 6 OS=Mus musculus OX=10090 GN=Myf6 PE=2 SV=1
13	P15173	3.20e-34	126	224	0.225	0.321	MYOG_HUMAN Myogenin OS=Homo sapiens OX=9606 GN=MYOG PE=1 SV=2
14	P19335	3.48e-34	127	242	0.200	0.264	MYF6_RAT Myogenic factor 6 OS=Rattus norvegicus OX=10116 GN=Myf6 PE=1 SV=1
15	Q01795	3.90e-34	127	242	0.200	0.264	MYF6_CHICK Myogenic factor 6 OS=Gallus gallus OX=9031 GN=MYF6 PE=2 SV=1
16	P23409	6.41e-34	126	242	0.200	0.264	MYF6_HUMAN Myogenic factor 6 OS=Homo sapiens OX=9606 GN=MYF6 PE=1 SV=1
17	Q6VNZ9	2.06e-33	125	239	0.194	0.259	MYF6_DANRE Myogenic factor 6 OS=Danio rerio OX=7955 GN=myf6 PE=2 SV=1
18	C4P6Q3	1.15e-32	122	227	0.231	0.326	C4P6Q3_CHICK Myogenin OS=Gallus gallus OX=9031 GN=MYOG PE=2 SV=1
19	P17920	1.15e-32	122	227	0.231	0.326	MYOG_CHICK Myogenin OS=Gallus gallus OX=9031 GN=MYOG PE=2 SV=1
20	P12979	4.60e-32	121	224	0.178	0.254	MYOG_MOUSE Myogenin OS=Mus musculus OX=10090 GN=Myog PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01586 Basic	2.6e-25	100.7	Myogenic Basic domain
2	PF00010 HLH	2.7e-10	51.4	Helix-loop-helix DNA-binding domain
3	PF12232 Myf5	1.8e-21	87.9	Myogenic determination factor 5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000250003

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262965	0.999	Transcription factor E2-alpha
2	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
3	9606.ENSP00000332973	0.998	Mothers against decapentaplegic homolog 3
4	9606.ENSP00000212015	0.997	NAD-dependent protein deacetylase sirtuin-1
5	9606.ENSP00000263754	0.997	Histone acetyltransferase KAT2B
6	9606.ENSP00000362649	0.997	Histone deacetylase 1
7	9606.ENSP00000346389	0.996	Myocyte-specific enhancer factor 2A
8	9606.ENSP00000262367	0.994	CREB-binding protein
9	9606.ENSP00000262188	0.992	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
10	9606.ENSP00000271555	0.991	Myocyte-specific enhancer factor 2D
11	9606.ENSP00000340874	0.991	Myocyte-specific enhancer factor 2C
12	9606.ENSP00000365280	0.985	DNA-binding protein inhibitor ID-1
13	9606.ENSP00000428205	0.981	F-box only protein 32
14	9606.ENSP00000229795	0.976	Mitogen-activated protein kinase 14
15	9606.ENSP00000337976	0.971	Histone-lysine N-methyltransferase SUV39H1
16	9606.ENSP00000264657	0.966	Signal transducer and activator of transcription 3
17	9606.ENSP00000431813	0.966	Cysteine and glycine-rich protein 3
18	9606.ENSP00000375942	0.964	TATA-box-binding protein
19	9606.ENSP00000380033	0.962	Probable ATP-dependent RNA helicase DDX17
20	9606.ENSP00000451828	0.959	RAC-alpha serine/threonine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140297	0.999	DNA-binding transcription factor binding
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.998	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0061629	0.993	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000987	0.936	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.934	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0016922	0.848	nuclear receptor binding
GO:0070888	0.635	E-box binding
GO:0043425	0.421	bHLH transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0010468	0.988	regulation of gene expression
GO:0051252	0.988	regulation of RNA metabolic process
GO:0009889	0.987	regulation of biosynthetic process
GO:0048856	0.986	anatomical structure development
GO:0048522	0.985	positive regulation of cellular process
GO:0031326	0.981	regulation of cellular biosynthetic process
GO:0010556	0.979	regulation of macromolecule biosynthetic process
GO:0006355	0.952	regulation of DNA-templated transcription
GO:0048869	0.947	cellular developmental process
GO:0061061	0.943	muscle structure development
GO:0030154	0.943	cell differentiation
GO:0006357	0.912	regulation of transcription by RNA polymerase II
GO:0051173	0.909	positive regulation of nitrogen compound metabolic process
GO:0031325	0.909	positive regulation of cellular metabolic process
GO:0010604	0.906	positive regulation of macromolecule metabolic process
GO:0051254	0.903	positive regulation of RNA metabolic process
GO:0009891	0.883	positive regulation of biosynthetic process
GO:0048513	0.871	animal organ development
GO:0045893	0.858	positive regulation of DNA-templated transcription
GO:0009888	0.810	tissue development
GO:0045944	0.807	positive regulation of transcription by RNA polymerase II
GO:0032501	0.797	multicellular organismal process
GO:0050793	0.745	regulation of developmental process
GO:0008152	0.673	metabolic process
GO:0050896	0.657	response to stimulus
GO:0071704	0.645	organic substance metabolic process
GO:0045595	0.644	regulation of cell differentiation
GO:0042692	0.637	muscle cell differentiation
GO:0060537	0.582	muscle tissue development
GO:0044238	0.564	primary metabolic process
GO:0007517	0.522	muscle organ development
GO:0045597	0.511	positive regulation of cell differentiation
GO:0006807	0.492	nitrogen compound metabolic process
GO:0048519	0.486	negative regulation of biological process
GO:0043170	0.460	macromolecule metabolic process
GO:0051147	0.446	regulation of muscle cell differentiation
GO:0051146	0.442	striated muscle cell differentiation
GO:0044237	0.439	cellular metabolic process
GO:0014902	0.416	myotube differentiation
GO:0048523	0.409	negative regulation of cellular process
GO:0007275	0.364	multicellular organism development
GO:0051716	0.320	cellular response to stimulus
GO:0051128	0.308	regulation of cellular component organization
GO:0060538	0.307	skeletal muscle organ development
GO:0007519	0.300	skeletal muscle tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.734	cytoplasm
GO:0032991	0.694	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]