StarFunc result for job id P15173

User Input

>input (224 residues)
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEH
CPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE
ILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFS
ANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12979	0.505	0.505	2.120E-30	224	0.951	0.951	P12979.pdb.gz	MYOG_MOUSE Myogenin OS=Mus musculus OX=10090 GN=Myog PE=1 SV=2
2	AFDB:C4P6Q3	0.451	0.446	9.962E-22	227	0.710	0.700	C4P6Q3.pdb.gz	C4P6Q3_CHICK Myogenin OS=Gallus gallus OX=9031 GN=MYOG PE=2 SV=1
3	AFDB:P20428	0.430	0.343	4.872E-20	287	0.701	0.547	P20428.pdb.gz	MYOG_RAT Myogenin OS=Rattus norvegicus OX=10116 GN=Myog PE=1 SV=1
4	AFDB:B0S6I5	0.411	0.365	3.288E-16	256	0.594	0.520	B0S6I5.pdb.gz
5	AFDB:P15375	0.334	0.311	3.501E-14	242	0.491	0.455	P15375.pdb.gz	MYF6_MOUSE Myogenic factor 6 OS=Mus musculus OX=10090 GN=Myf6 PE=2 SV=1
6	AFDB:Q01795	0.349	0.325	1.280E-13	242	0.464	0.430	Q01795.pdb.gz	MYF6_CHICK Myogenic factor 6 OS=Gallus gallus OX=9031 GN=MYF6 PE=2 SV=1
7	AFDB:Q6VNZ9	0.353	0.332	1.457E-13	239	0.433	0.406	Q6VNZ9.pdb.gz	MYF6_DANRE Myogenic factor 6 OS=Danio rerio OX=7955 GN=myf6 PE=2 SV=1
8	AFDB:P13349	0.347	0.306	1.823E-10	255	0.411	0.361	P13349.pdb.gz	MYF5_HUMAN Myogenic factor 5 OS=Homo sapiens OX=9606 GN=MYF5 PE=1 SV=2
9	AFDB:Q5CZP8	0.344	0.327	2.363E-10	237	0.402	0.380	Q5CZP8.pdb.gz
10	AFDB:P24699	0.313	0.279	3.486E-10	255	0.415	0.365	P24699.pdb.gz	MYF5_MOUSE Myogenic factor 5 OS=Mus musculus OX=10090 GN=Myf5 PE=1 SV=1
11	PDB:7r5jV0	0.148	0.124	1.569	273	0.116	0.095	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:2bskD	0.143	0.308	2.812	90	0.076	0.189	2bskD.pdb.gz
13	PDB:6zx9C	0.121	0.108	3.001	257	0.094	0.082	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
14	PDB:3ojaA	0.271	0.140	3.202	482	0.054	0.025	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
15	PDB:7r72w	0.118	0.137	3.416	189	0.112	0.132	7r72w.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
16	PDB:6nmiC	0.110	0.062	4.149	408	0.058	0.032	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.
17	PDB:5apnh	0.107	0.163	5.738	119	0.098	0.185	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:7xtbR	0.140	0.121	5.738	278	0.067	0.054	7xtbR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
19	PDB:7edxl	0.140	0.244	6.122	107	0.080	0.168	7edxl.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:2bskC	0.136	0.325	6.532	79	0.049	0.139	2bskC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15173	1.69e-167	462	224	1.000	1.000	MYOG_HUMAN Myogenin OS=Homo sapiens OX=9606 GN=MYOG PE=1 SV=2
2	P12979	3.54e-159	441	224	0.951	0.951	MYOG_MOUSE Myogenin OS=Mus musculus OX=10090 GN=Myog PE=1 SV=2
3	P20428	9.95e-106	308	287	0.670	0.523	MYOG_RAT Myogenin OS=Rattus norvegicus OX=10116 GN=Myog PE=1 SV=1
4	C4P6Q3	1.07e-100	293	227	0.692	0.683	C4P6Q3_CHICK Myogenin OS=Gallus gallus OX=9031 GN=MYOG PE=2 SV=1
5	P17920	1.07e-100	293	227	0.692	0.683	MYOG_CHICK Myogenin OS=Gallus gallus OX=9031 GN=MYOG PE=2 SV=1
6	Q9DG26	5.17e-71	219	256	0.576	0.504	Q9DG26_DANRE Myogenin OS=Danio rerio OX=7955 GN=zgc:100763 PE=2 SV=1
7	P15375	9.33e-52	169	242	0.496	0.459	MYF6_MOUSE Myogenic factor 6 OS=Mus musculus OX=10090 GN=Myf6 PE=2 SV=1
8	P19335	1.45e-49	164	242	0.496	0.459	MYF6_RAT Myogenic factor 6 OS=Rattus norvegicus OX=10116 GN=Myf6 PE=1 SV=1
9	P23409	7.58e-48	159	242	0.504	0.467	MYF6_HUMAN Myogenic factor 6 OS=Homo sapiens OX=9606 GN=MYF6 PE=1 SV=1
10	Q01795	6.36e-46	154	242	0.438	0.405	MYF6_CHICK Myogenic factor 6 OS=Gallus gallus OX=9031 GN=MYF6 PE=2 SV=1
11	Q6VNZ9	1.65e-44	150	239	0.366	0.343	MYF6_DANRE Myogenic factor 6 OS=Danio rerio OX=7955 GN=myf6 PE=2 SV=1
12	P24699	1.65e-38	135	255	0.366	0.322	MYF5_MOUSE Myogenic factor 5 OS=Mus musculus OX=10090 GN=Myf5 PE=1 SV=1
13	P13349	7.03e-38	134	255	0.420	0.369	MYF5_HUMAN Myogenic factor 5 OS=Homo sapiens OX=9606 GN=MYF5 PE=1 SV=2
14	Q9DDW0	1.98e-36	130	237	0.299	0.283	Q9DDW0_DANRE Myogenic factor OS=Danio rerio OX=7955 GN=myf-5 PE=2 SV=1
15	P10085	2.52e-36	131	318	0.326	0.230	MYOD1_MOUSE Myoblast determination protein 1 OS=Mus musculus OX=10090 GN=Myod1 PE=1 SV=2
16	P13904	3.53e-36	130	289	0.335	0.260	MYODA_XENLA Myoblast determination protein 1 homolog A OS=Xenopus laevis OX=8355 GN=myod1-a PE=2 SV=1
17	Q02346	4.41e-35	128	318	0.326	0.230	MYOD1_RAT Myoblast determination protein 1 OS=Rattus norvegicus OX=10116 GN=Myod1 PE=1 SV=1
18	P15172	5.00e-35	128	320	0.321	0.225	MYOD1_HUMAN Myoblast determination protein 1 OS=Homo sapiens OX=9606 GN=MYOD1 PE=1 SV=3
19	Q90477	7.32e-35	127	275	0.299	0.244	MYOD1_DANRE Myoblast determination protein 1 homolog OS=Danio rerio OX=7955 GN=myod1 PE=1 SV=2
20	Q08856	8.71e-35	126	258	0.375	0.326	MYF5_CHICK Myogenic factor 5 OS=Gallus gallus OX=9031 GN=MYF5 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01586 Basic	1.9e-20	85.1	Myogenic Basic domain
2	PF11279 DUF3080	49	14.6	Protein of unknown function (DUF3080)
3	PF00010 HLH	6.3e-09	47.0	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000241651

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262965	0.975	Transcription factor E2-alpha
2	9606.ENSP00000344456	0.944	Catenin beta-1
3	9606.ENSP00000219252	0.943	DNA-directed RNA polymerase II subunit RPB3
4	9606.ENSP00000381382	0.932	Transcription factor 4
5	9606.ENSP00000340874	0.929	Myocyte-specific enhancer factor 2C
6	9606.ENSP00000388940	0.929	Transcription factor 12
7	9606.ENSP00000271555	0.928	Myocyte-specific enhancer factor 2D
8	9606.ENSP00000228644	0.921	Myogenic factor 5
9	9606.ENSP00000346389	0.908	Myocyte-specific enhancer factor 2A
10	9606.ENSP00000484656	0.907	MyoD family inhibitor domain-containing protein
11	9606.ENSP00000364524	0.906	Paired box protein Pax-7
12	9606.ENSP00000428205	0.863	F-box only protein 32
13	9606.ENSP00000260950	0.860	Growth/differentiation factor 8
14	9606.ENSP00000375921	0.853	Paired box protein Pax-3
15	9606.ENSP00000419712	0.841	Protein myomaker
16	9606.ENSP00000357206	0.821	Nestin
17	9606.ENSP00000250003	0.815	Myoblast determination protein 1
18	9606.ENSP00000265354	0.812	Serum response factor
19	9606.ENSP00000386041	0.807	Myosin-6
20	9606.ENSP00000226207	0.801	Myosin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0070888	0.901	E-box binding
GO:0008134	0.546	transcription factor binding
GO:0003682	0.480	chromatin binding
GO:0140297	0.470	DNA-binding transcription factor binding
GO:0031490	0.465	chromatin DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0048856	0.989	anatomical structure development
GO:0048518	0.986	positive regulation of biological process
GO:0080090	0.985	regulation of primary metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0010468	0.985	regulation of gene expression
GO:0019219	0.984	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.983	positive regulation of cellular process
GO:0009987	0.979	cellular process
GO:0031326	0.978	regulation of cellular biosynthetic process
GO:0061061	0.975	muscle structure development
GO:0010556	0.973	regulation of macromolecule biosynthetic process
GO:0051252	0.971	regulation of RNA metabolic process
GO:0006355	0.963	regulation of DNA-templated transcription
GO:0010604	0.962	positive regulation of macromolecule metabolic process
GO:0031325	0.953	positive regulation of cellular metabolic process
GO:0051173	0.949	positive regulation of nitrogen compound metabolic process
GO:0009891	0.937	positive regulation of biosynthetic process
GO:0045893	0.929	positive regulation of DNA-templated transcription
GO:0006357	0.921	regulation of transcription by RNA polymerase II
GO:0007519	0.906	skeletal muscle tissue development
GO:0045944	0.869	positive regulation of transcription by RNA polymerase II
GO:0030154	0.618	cell differentiation
GO:0050896	0.616	response to stimulus
GO:0032501	0.567	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.845	protein-containing complex
GO:0005737	0.782	cytoplasm
GO:0005667	0.397	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]