StarFunc result for job id P15260

User Input

>input (489 residues)
MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFT
VEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFA
VCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNG
SEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN
SSIKGSLWIPVVAALLLFLVLSLVFICFYIKKINPLKEKSIILPKSLISVVRSATLETKP
ESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELSSITEVVTTEE
NIPDVVPGSHLTPIERESSSPLSSNQSEPGSIALNSYHSRNCSESDHSRNGFDTDSSCLE
SHSSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYR
PTEDSKEFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z3Y2	0.550	0.550	7.711E-73	489	1.000	1.000	A0A0S2Z3Y2.pdb.gz	A0A0S2Z3Y2_HUMAN Interferon gamma receptor 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=IFNGR1 PE=2 SV=1
2	AFDB:P15261	0.450	0.459	2.421E-43	477	0.481	0.493	P15261.pdb.gz	INGR1_MOUSE Interferon gamma receptor 1 OS=Mus musculus OX=10090 GN=Ifngr1 PE=1 SV=3
3	AFDB:Q5TFC9	0.366	0.838	2.048E-32	210	0.423	0.986	Q5TFC9.pdb.gz	Q5TFC9_HUMAN Interferon gamma receptor 1 OS=Homo sapiens OX=9606 GN=IFNGR1 PE=1 SV=2
4	AFDB:Q8N6P7	0.378	0.329	6.110E-18	574	0.160	0.136	Q8N6P7.pdb.gz	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL22RA1 PE=1 SV=1
5	AFDB:D9IL84	0.364	0.315	6.454E-18	573	0.188	0.161	D9IL84.pdb.gz	D9IL84_DANRE Cytokine receptor family member b14 OS=Danio rerio OX=7955 GN=crfb14 PE=2 SV=1
6	AFDB:Q8CGK5	0.396	0.367	2.277E-17	535	0.196	0.179	Q8CGK5.pdb.gz	INLR1_MOUSE Interferon lambda receptor 1 OS=Mus musculus OX=10090 GN=Ifnlr1 PE=1 SV=1
7	AFDB:Q80XZ4	0.361	0.311	6.816E-17	581	0.141	0.119	Q80XZ4.pdb.gz	I22R1_MOUSE Interleukin-22 receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Il22ra1 PE=1 SV=1
8	AFDB:Q8IU57	0.385	0.365	9.471E-17	520	0.180	0.169	Q8IU57.pdb.gz	INLR1_HUMAN Interferon lambda receptor 1 OS=Homo sapiens OX=9606 GN=IFNLR1 PE=1 SV=1
9	AFDB:P40190	0.232	0.139	3.529E-15	918	0.137	0.073	P40190.pdb.gz	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
10	AFDB:Q00560	0.232	0.139	1.930E-14	917	0.127	0.068	Q00560.pdb.gz	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
11	PDB:3besR	0.337	0.616	2.252E-13	250	0.100	0.196	3besR.pdb.gz
12	PDB:7u7nC	0.288	0.591	1.103E-9	200	0.053	0.130	7u7nC.pdb.gz
13	PDB:7z0lB	0.261	0.327	7.111E-8	370	0.055	0.073	7z0lB.pdb.gz
14	PDB:6pxvA	0.218	0.145	4.583E-5	823	0.067	0.040	6pxvA.pdb.gz
15	PDB:5mj3A	0.203	0.290	6.028E-5	302	0.061	0.099	5mj3A.pdb.gz
16	PDB:6kzbC	0.189	0.155	8.848E-5	649	0.057	0.043	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.
17	PDB:4pygA	0.201	0.157	1.043E-4	685	0.057	0.041	4pygA.pdb.gz	Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.
18	PDB:8dtlA	0.201	0.145	1.164E-4	741	0.061	0.040	8dtlA.pdb.gz
19	PDB:2q3zA	0.202	0.162	1.229E-4	655	0.057	0.043	2q3zA.pdb.gz	Transglutaminase 2 undergoes a large conformational change upon activation
20	PDB:6pyhD	0.200	0.138	1.372E-4	798	0.070	0.043	6pyhD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3Y2	0.0	1001	489	1.000	1.000	A0A0S2Z3Y2_HUMAN Interferon gamma receptor 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=IFNGR1 PE=2 SV=1
2	A0A2R8Y4U4	0.0	942	479	0.943	0.962	A0A2R8Y4U4_HUMAN Interferon gamma receptor 1 OS=Homo sapiens OX=9606 GN=IFNGR1 PE=1 SV=1
3	A0A2R8Y7R1	0.0	943	470	0.945	0.983	A0A2R8Y7R1_HUMAN Interferon gamma receptor 1 OS=Homo sapiens OX=9606 GN=IFNGR1 PE=1 SV=1
4	A0A2R8YFL3	0.0	917	448	0.916	1.000	A0A2R8YFL3_HUMAN Interferon gamma receptor 1 OS=Homo sapiens OX=9606 GN=IFNGR1 PE=1 SV=1
5	P15260	0.0	1001	489	1.000	1.000	INGR1_HUMAN Interferon gamma receptor 1 OS=Homo sapiens OX=9606 GN=IFNGR1 PE=1 SV=1
6	Q5TFC9	0.0	908	455	0.930	1.000	Q5TFC9_HUMAN Interferon gamma receptor 1 OS=Homo sapiens OX=9606 GN=IFNGR1 PE=1 SV=2
7	P15261	1.99e-143	422	477	0.509	0.522	INGR1_MOUSE Interferon gamma receptor 1 OS=Mus musculus OX=10090 GN=Ifngr1 PE=1 SV=3
8	Q9QZ62	3.72e-129	385	464	0.476	0.502	Q9QZ62_RAT Interferon-gamma receptor OS=Rattus norvegicus OX=10116 GN=Ifngr1 PE=2 SV=1
9	Q6P6T3	2.45e-128	382	464	0.474	0.500	Q6P6T3_RAT Interferon gamma receptor 1 OS=Rattus norvegicus OX=10116 GN=Ifngr1 PE=1 SV=1
10	F7FHZ1	3.34e-128	382	473	0.474	0.490	F7FHZ1_RAT Interferon gamma receptor 1 OS=Rattus norvegicus OX=10116 GN=Ifngr1 PE=1 SV=1
11	Q6PHB0	1.07e-09	63.2	546	0.143	0.128	I20RA_MOUSE Interleukin-20 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il20ra PE=2 SV=2
12	Q80XF5	2.43e-09	59.7	230	0.112	0.239	I22R2_MOUSE Interleukin-22 receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Il22ra2 PE=1 SV=2
13	Q9UHF4	3.65e-09	61.2	553	0.082	0.072	I20RA_HUMAN Interleukin-20 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL20RA PE=1 SV=2
14	Q61190	2.99e-07	54.7	349	0.127	0.178	I10R2_MOUSE Interleukin-10 receptor subunit beta OS=Mus musculus OX=10090 GN=Il10rb PE=1 SV=1
15	Q08334	2.74e-05	48.5	325	0.129	0.194	I10R2_HUMAN Interleukin-10 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL10RB PE=1 SV=2
16	K9JA28	4.02e-05	48.5	567	0.108	0.093	INLR1_CHICK Interferon lambda receptor 1 OS=Gallus gallus OX=9031 GN=IFNLR1 PE=2 SV=1
17	P17181	6.97e-04	44.7	557	0.074	0.065	INAR1_HUMAN Interferon alpha/beta receptor 1 OS=Homo sapiens OX=9606 GN=IFNAR1 PE=1 SV=3
18	B6RLL0	0.001	43.5	389	0.119	0.149	B6RLL0_ONCMY Interferon-gamma receptor 1 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=IFNGR1 PE=2 SV=1
19	A1IMH9	0.002	43.1	391	0.119	0.148	A1IMH9_ONCMY Interferon-gamma receptor alpha chain OS=Oncorhynchus mykiss OX=8022 GN=ifngr1 PE=2 SV=1
20	Q8N6P7	0.005	42.0	574	0.057	0.049	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL22RA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07140 IFNGR1	5.5e-44	160.9	Interferon gamma receptor (IFNGR1)
2	PF09294 Interfer-bind	0.024	26.3	Interferon-alpha/beta receptor, fibronectin type III
3	PF01108 Tissue_fac	2.1e-16	71.1	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356713

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229135	0.999	Interferon gamma
2	9606.ENSP00000290219	0.999	Interferon gamma receptor 2
3	9606.ENSP00000343204	0.999	Tyrosine-protein kinase JAK1
4	9606.ENSP00000354394	0.999	Signal transducer and activator of transcription 1-alpha/beta
5	9606.ENSP00000371067	0.999	Tyrosine-protein kinase JAK2
6	9606.ENSP00000329418	0.994	Suppressor of cytokine signaling 1
7	9606.ENSP00000270139	0.978	Interferon alpha/beta receptor 1
8	9606.ENSP00000343957	0.953	Interferon alpha/beta receptor 2
9	9606.ENSP00000428056	0.945	Phosphatidylinositol 3-kinase regulatory subunit alpha
10	9606.ENSP00000309597	0.941	Mitogen-activated protein kinase kinase kinase 11
11	9606.ENSP00000340944	0.936	Tyrosine-protein phosphatase non-receptor type 11
12	9606.ENSP00000311857	0.933	Tyrosine-protein phosphatase non-receptor type 2
13	9606.ENSP00000263967	0.920	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
14	9606.ENSP00000391592	0.917	Tyrosine-protein phosphatase non-receptor type 6
15	9606.ENSP00000360683	0.916	Tyrosine-protein phosphatase non-receptor type 1
16	9606.ENSP00000378217	0.907	Protein kinase C delta type
17	9606.ENSP00000382423	0.903	Mitogen-activated protein kinase kinase kinase 1
18	9606.ENSP00000264033	0.902	E3 ubiquitin-protein ligase CBL
19	9606.ENSP00000364802	0.902	Heat shock 70 kDa protein 1A
20	9606.ENSP00000319060	0.901	Calcium/calmodulin-dependent protein kinase type II subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004904	1.000	interferon receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0051716	0.979	cellular response to stimulus
GO:0007165	0.972	signal transduction
GO:0009605	0.964	response to external stimulus
GO:0044419	0.956	biological process involved in interspecies interaction between organisms
GO:0043207	0.946	response to external biotic stimulus
GO:0009615	0.943	response to virus
GO:0048518	0.795	positive regulation of biological process
GO:0019222	0.768	regulation of metabolic process
GO:0048583	0.727	regulation of response to stimulus
GO:0060255	0.725	regulation of macromolecule metabolic process
GO:0048522	0.722	positive regulation of cellular process
GO:0009893	0.677	positive regulation of metabolic process
GO:0006950	0.550	response to stress
GO:0006952	0.539	defense response
GO:0002376	0.509	immune system process
GO:0010468	0.484	regulation of gene expression
GO:0010604	0.481	positive regulation of macromolecule metabolic process
GO:0042221	0.478	response to chemical
GO:0010646	0.468	regulation of cell communication
GO:0007166	0.462	cell surface receptor signaling pathway
GO:0010033	0.458	response to organic substance
GO:0080090	0.456	regulation of primary metabolic process
GO:0051171	0.454	regulation of nitrogen compound metabolic process
GO:0070887	0.454	cellular response to chemical stimulus
GO:0009966	0.438	regulation of signal transduction
GO:0071310	0.435	cellular response to organic substance
GO:0051239	0.424	regulation of multicellular organismal process
GO:0034097	0.424	response to cytokine
GO:0006955	0.416	immune response
GO:0071345	0.392	cellular response to cytokine stimulus
GO:0048519	0.370	negative regulation of biological process
GO:0031323	0.364	regulation of cellular metabolic process
GO:0048584	0.341	positive regulation of response to stimulus
GO:0051173	0.317	positive regulation of nitrogen compound metabolic process
GO:0051246	0.314	regulation of protein metabolic process
GO:0051240	0.310	positive regulation of multicellular organismal process
GO:0098542	0.310	defense response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.362	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]