StarFunc result for job id P15291

User Input

>input (398 residues)
MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPL
QGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVP
HTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAI
IIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYD
YTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTI
NGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIA
HTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15291	1.000	1.000	1.895E-81	398	1.000	1.000	P15291.pdb.gz	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
2	AFDB:P08037	0.724	0.717	1.454E-73	402	0.857	0.848	P08037.pdb.gz	B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
3	AFDB:P15535	0.714	0.712	1.747E-73	399	0.867	0.865	P15535.pdb.gz	B4GT1_MOUSE Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
4	AFDB:O60909	0.703	0.752	2.277E-51	372	0.513	0.548	O60909.pdb.gz	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
5	AFDB:A0A384NY44	0.674	0.683	3.790E-44	393	0.399	0.405	A0A384NY44.pdb.gz	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
6	AFDB:B2RAZ5	0.672	0.776	1.515E-41	344	0.347	0.401	B2RAZ5.pdb.gz	B2RAZ5_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=2 SV=1
7	AFDB:Q9GUM2	0.667	0.693	2.522E-40	383	0.344	0.358	Q9GUM2.pdb.gz	BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1
8	AFDB:Q68EK0	0.558	0.694	1.484E-39	319	0.447	0.558	Q68EK0.pdb.gz
9	AFDB:Q7KN92	0.665	0.657	1.050E-38	403	0.319	0.315	Q7KN92.pdb.gz	Q7KN92_DROME Beta1,4-N-acetylgalactosaminyltransferase A OS=Drosophila melanogaster OX=7227 GN=beta4GalNAcTA PE=2 SV=1
10	AFDB:A0A1S6M251	0.651	0.667	1.186E-35	388	0.309	0.317	A0A1S6M251.pdb.gz	B4GT5_PIG Beta-1,4-galactosyltransferase 5 OS=Sus scrofa OX=9823 GN=B4GALT5 PE=1 SV=2
11	PDB:2d7iA	0.312	0.240	1.019E-4	536	0.095	0.071	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
12	PDB:6pxuB	0.337	0.266	1.019E-4	532	0.103	0.077	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
13	PDB:6h0bB	0.318	0.251	1.224E-4	521	0.088	0.067	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
14	PDB:4fixA	0.323	0.214	1.471E-4	629	0.085	0.054	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
15	PDB:4d11C	0.287	0.264	4.698E-4	436	0.078	0.071	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
16	PDB:4decA	0.292	0.384	6.000E-4	284	0.095	0.134	4decA.pdb.gz	Mechanistic insights into the retaining glucosyl-3-phosphoglycerate synthase from mycobacteria.
17	PDB:4d0tA	0.348	0.287	6.378E-4	496	0.065	0.052	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
18	PDB:6iwqA	0.288	0.218	1.249E-3	546	0.088	0.064	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
19	PDB:1ll0B	0.185	0.253	1.803E-3	267	0.058	0.086	1ll0B.pdb.gz
20	PDB:6fxrA	0.281	0.173	2.602E-3	700	0.095	0.054	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08037	0.0	697	402	0.854	0.846	B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
2	P15291	0.0	820	398	1.000	1.000	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
3	P15535	0.0	695	399	0.867	0.865	B4GT1_MOUSE Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
4	Q99PC2	0.0	669	393	0.819	0.830	Q99PC2_CRIGR Beta-1,4-galactosyltransferase OS=Cricetulus griseus OX=10029 GN=beta4GalT-1 PE=2 SV=1
5	Q86XA6	9.70e-154	434	225	0.543	0.960	Q86XA6_HUMAN B4GALT1 protein OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=1
6	O60909	3.26e-133	388	372	0.518	0.554	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
7	Q9Z2Y2	5.60e-133	387	369	0.460	0.496	B4GT2_MOUSE Beta-1,4-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B4galt2 PE=2 SV=1
8	A0A384NY44	1.21e-101	308	393	0.389	0.394	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
9	O60512	1.21e-101	308	393	0.389	0.394	B4GT3_HUMAN Beta-1,4-galactosyltransferase 3 OS=Homo sapiens OX=9606 GN=B4GALT3 PE=1 SV=2
10	B2RAZ5	1.57e-93	286	344	0.344	0.398	B2RAZ5_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=2 SV=1
11	O60513	1.57e-93	286	344	0.344	0.398	B4GT4_HUMAN Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1
12	Q9GUM2	2.72e-83	261	383	0.299	0.311	BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1
13	Q9JMK0	1.15e-76	244	388	0.317	0.325	B4GT5_MOUSE Beta-1,4-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B4galt5 PE=1 SV=2
14	A0A1S6M251	1.30e-76	244	388	0.327	0.335	B4GT5_PIG Beta-1,4-galactosyltransferase 5 OS=Sus scrofa OX=9823 GN=B4GALT5 PE=1 SV=2
15	O43286	7.89e-76	242	388	0.314	0.322	B4GT5_HUMAN Beta-1,4-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B4GALT5 PE=1 SV=1
16	Q802Y5	1.87e-75	241	381	0.327	0.341	Q802Y5_DANRE Beta-1,4-galactosyltransferase OS=Danio rerio OX=7955 GN=zgc:55730 PE=2 SV=1
17	Q3YL68	6.94e-75	239	381	0.304	0.318	B4GT5_DANRE Beta-1,4-galactosyltransferase 5 OS=Danio rerio OX=7955 GN=b4galt5 PE=2 SV=2
18	Q7KN92	1.11e-71	232	403	0.264	0.261	Q7KN92_DROME Beta1,4-N-acetylgalactosaminyltransferase A OS=Drosophila melanogaster OX=7227 GN=beta4GalNAcTA PE=2 SV=1
19	Q9UBX8	2.63e-70	228	382	0.294	0.306	B4GT6_HUMAN Beta-1,4-galactosyltransferase 6 OS=Homo sapiens OX=9606 GN=B4GALT6 PE=1 SV=1
20	O88419	3.55e-70	227	382	0.302	0.314	B4GT6_RAT Beta-1,4-galactosyltransferase 6 OS=Rattus norvegicus OX=10116 GN=B4galt6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10111 Glyco_tranf_2_2	2.8	18.9	Glycosyltransferase like family 2
2	PF02709 Glyco_transf_7C	3.1e-26	102.2	N-terminal domain of galactosyltransferase
3	PF13733 Glyco_transf_7N	3.2e-56	200.0	N-terminal region of glycosyl transferase group 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369055

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301046	0.997	Alpha-lactalbumin
2	9606.ENSP00000353910	0.978	Alpha-(1,6)-fucosyltransferase
3	9606.ENSP00000376456	0.977	Beta-1,3-galactosyltransferase 1
4	9606.ENSP00000313398	0.975	Alpha-(1,3)-fucosyltransferase 6
5	9606.ENSP00000169298	0.971	Beta-galactoside alpha-2,6-sialyltransferase 1
6	9606.ENSP00000386377	0.964	Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
7	9606.ENSP00000466880	0.963	Alpha-(1,3)-fucosyltransferase 5
8	9606.ENSP00000356404	0.962	Beta-1,3-galactosyltransferase 2
9	9606.ENSP00000381699	0.961	Beta-1,3-galactosyltransferase 5
10	9606.ENSP00000305595	0.959	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
11	9606.ENSP00000262915	0.955	ST3 beta-galactoside alpha-2,3-sialyltransferase 3
12	9606.ENSP00000386942	0.955	Beta-galactoside alpha-2,6-sialyltransferase 2
13	9606.ENSP00000305603	0.954	Galactoside 3(4)-L-fucosyltransferase
14	9606.ENSP00000436047	0.953	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
15	9606.ENSP00000319636	0.952	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4
16	9606.ENSP00000368917	0.950	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
17	9606.ENSP00000316173	0.947	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
18	9606.ENSP00000384794	0.946	Lactosylceramide 4-alpha-galactosyltransferase
19	9606.ENSP00000480884	0.942	Type 2 lactosamine alpha-2,3-sialyltransferase
20	9606.ENSP00000321874	0.940	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0035250	0.999	UDP-galactosyltransferase activity
GO:0140096	0.607	catalytic activity, acting on a protein
GO:0003831	0.581	beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity
GO:0015631	0.480	tubulin binding
GO:0043167	0.448	ion binding
GO:0048487	0.443	beta-tubulin binding
GO:0043014	0.440	alpha-tubulin binding
GO:0042802	0.430	identical protein binding
GO:0030145	0.413	manganese ion binding
GO:0140103	0.320	catalytic activity, acting on a glycoprotein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:1901564	0.979	organonitrogen compound metabolic process
GO:0009101	0.967	glycoprotein biosynthetic process
GO:0005975	0.966	carbohydrate metabolic process
GO:0009311	0.959	oligosaccharide metabolic process
GO:0006486	0.942	protein glycosylation
GO:0016051	0.932	carbohydrate biosynthetic process
GO:0009312	0.896	oligosaccharide biosynthetic process
GO:0044262	0.881	cellular carbohydrate metabolic process
GO:0034637	0.811	cellular carbohydrate biosynthetic process
GO:0005984	0.742	disaccharide metabolic process
GO:0046351	0.619	disaccharide biosynthetic process
GO:0006487	0.380	protein N-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0031090	0.997	organelle membrane
GO:0000139	0.992	Golgi membrane
GO:0005576	0.976	extracellular region
GO:0005615	0.836	extracellular space
GO:0071944	0.516	cell periphery
GO:1903561	0.344	extracellular vesicle
GO:0070062	0.301	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	0.999	Hexosyltransferases.
RHEA:22932	0.581	an N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP
EC:2.4.1.38	0.581	beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase.

[back to server]