StarFunc result for job id P15309

User Input

>input (386 residues)
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKE
SSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNL
AALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKR
LHPYKDFIATLGKLSGLHGQDLFGIWSKVYDPLYCESVHNFTLPSWATEDTMTKLRELSE
LSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMYSAHDTTVSGLQMAL
DVYNGLLPPYASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELV
GPVIPQDWSTECMTTNSHQGTEDSTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15309	1.000	1.000	4.271E-77	386	1.000	1.000	P15309.pdb.gz	PPAP_HUMAN Prostatic acid phosphatase OS=Homo sapiens OX=9606 GN=ACP3 PE=1 SV=3
2	AFDB:P20646	0.927	0.939	1.616E-65	381	0.793	0.803	P20646.pdb.gz	PPAP_RAT Prostatic acid phosphatase OS=Rattus norvegicus OX=10116 GN=Acp3 PE=1 SV=2
3	AFDB:A6H730	0.914	0.911	1.583E-64	387	0.808	0.806	A6H730.pdb.gz	PPAP_BOVIN Prostatic acid phosphatase OS=Bos taurus OX=9913 GN=ACP3 PE=2 SV=1
4	PDB:1nd6B	0.885	0.996	2.763E-64	343	0.886	0.997	1nd6B.pdb.gz	Crystal structures of human prostatic acid phosphatase in complex with a phosphate ion and alpha-benzylaminobenzylphosphonic acid update the mechanistic picture and offer new insights into inhibitor design
5	PDB:1rptA	0.877	0.989	7.640E-54	342	0.736	0.830	1rptA.pdb.gz	Crystal structures of rat acid phosphatase complexed with the transition-state analogs vanadate and molybdate. Implications for the reaction mechanism.
6	AFDB:P11117	0.875	0.799	2.866E-47	423	0.474	0.433	P11117.pdb.gz	PPAL_HUMAN Lysosomal acid phosphatase OS=Homo sapiens OX=9606 GN=ACP2 PE=1 SV=3
7	AFDB:P20611	0.883	0.806	2.866E-47	423	0.482	0.440	P20611.pdb.gz	PPAL_RAT Lysosomal acid phosphatase OS=Rattus norvegicus OX=10116 GN=Acp2 PE=1 SV=1
8	AFDB:A0A0G2KB67	0.866	0.884	2.811E-38	378	0.404	0.413	A0A0G2KB67.pdb.gz	A0A0G2KB67_RAT Acid phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Acp4 PE=4 SV=2
9	AFDB:Q9BZG2	0.850	0.773	1.972E-37	426	0.412	0.373	Q9BZG2.pdb.gz	PPAT_HUMAN Testicular acid phosphatase OS=Homo sapiens OX=9606 GN=ACP4 PE=1 SV=1
10	AFDB:Q8I0P9	0.832	0.709	2.190E-34	455	0.345	0.292	Q8I0P9.pdb.gz	Q8I0P9_DROME Acid phosphatase 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Acph-1 PE=1 SV=1
11	AFDB:Q19076	0.792	0.688	1.006E-26	449	0.295	0.254	Q19076.pdb.gz	PHO1_CAEEL Intestinal acid phosphatase OS=Caenorhabditis elegans OX=6239 GN=pho-1 PE=1 SV=1
12	AFDB:Q9NPH0	0.736	0.669	1.293E-22	428	0.251	0.227	Q9NPH0.pdb.gz	PPA6_HUMAN Lysophosphatidic acid phosphatase type 6 OS=Homo sapiens OX=9606 GN=ACP6 PE=1 SV=3
13	PDB:4jodA	0.680	0.693	9.934E-21	378	0.259	0.265	4jodA.pdb.gz
14	PDB:1nt4A	0.606	0.599	1.531E-14	391	0.171	0.169	1nt4A.pdb.gz	Functional insights revealed by the crystal structures of Escherichia coli glucose-1-phosphatase.
15	PDB:7z32A	0.603	0.570	3.729E-14	412	0.187	0.175	7z32A.pdb.gz
16	PDB:3dcyA	0.281	0.413	2.927E-5	247	0.101	0.158	3dcyA.pdb.gz
17	PDB:2yn2A	0.270	0.382	3.657E-5	254	0.119	0.181	2yn2A.pdb.gz
18	PDB:2h4zA	0.268	0.382	3.866E-5	255	0.135	0.204	2h4zA.pdb.gz	Seeing the process of histidine phosphorylation in human bisphosphoglycerate mutase.
19	PDB:1e58A	0.299	0.438	6.035E-5	247	0.106	0.166	1e58A.pdb.gz
20	PDB:4embA	0.303	0.442	1.942E-4	245	0.114	0.180	4embA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6H730	0.0	634	387	0.806	0.804	PPAP_BOVIN Prostatic acid phosphatase OS=Bos taurus OX=9913 GN=ACP3 PE=2 SV=1
2	P15309	0.0	801	386	1.000	1.000	PPAP_HUMAN Prostatic acid phosphatase OS=Homo sapiens OX=9606 GN=ACP3 PE=1 SV=3
3	P20646	0.0	585	381	0.793	0.803	PPAP_RAT Prostatic acid phosphatase OS=Rattus norvegicus OX=10116 GN=Acp3 PE=1 SV=2
4	Q8CE08	0.0	599	381	0.806	0.816	PPAP_MOUSE Prostatic acid phosphatase OS=Mus musculus OX=10090 GN=Acp3 PE=1 SV=1
5	P24638	5.65e-134	391	423	0.484	0.442	PPAL_MOUSE Lysosomal acid phosphatase OS=Mus musculus OX=10090 GN=Acp2 PE=1 SV=2
6	P20611	1.13e-130	383	423	0.477	0.435	PPAL_RAT Lysosomal acid phosphatase OS=Rattus norvegicus OX=10116 GN=Acp2 PE=1 SV=1
7	P11117	2.79e-130	382	423	0.479	0.437	PPAL_HUMAN Lysosomal acid phosphatase OS=Homo sapiens OX=9606 GN=ACP2 PE=1 SV=3
8	A0A0G2KB67	2.67e-98	302	487	0.412	0.326	A0A0G2KB67_RAT Acid phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Acp4 PE=4 SV=2
9	Q9BZG2	3.29e-96	295	426	0.402	0.364	PPAT_HUMAN Testicular acid phosphatase OS=Homo sapiens OX=9606 GN=ACP4 PE=1 SV=1
10	Q9VAD0	3.80e-74	239	438	0.334	0.295	Q9VAD0_DROME Acid phosphatase 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Acph-1 PE=1 SV=1
11	Q8I0P9	5.65e-74	239	455	0.334	0.284	Q8I0P9_DROME Acid phosphatase 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Acph-1 PE=1 SV=1
12	Q19076	9.03e-35	135	449	0.329	0.283	PHO1_CAEEL Intestinal acid phosphatase OS=Caenorhabditis elegans OX=6239 GN=pho-1 PE=1 SV=1
13	Q9NPH0	9.49e-23	101	428	0.285	0.257	PPA6_HUMAN Lysophosphatidic acid phosphatase type 6 OS=Homo sapiens OX=9606 GN=ACP6 PE=1 SV=3
14	Q8BP40	9.82e-20	92.4	418	0.272	0.251	PPA6_MOUSE Lysophosphatidic acid phosphatase type 6 OS=Mus musculus OX=10090 GN=Acp6 PE=1 SV=1
15	Q54PR9	8.07e-19	89.7	416	0.223	0.207	CF60_DICDI Counting factor 60 OS=Dictyostelium discoideum OX=44689 GN=cf60 PE=1 SV=1
16	Q8TE99	8.74e-12	68.6	480	0.205	0.165	PXYP1_HUMAN 2-phosphoxylose phosphatase 1 OS=Homo sapiens OX=9606 GN=PXYLP1 PE=1 SV=1
17	Q9USS6	2.90e-11	67.0	462	0.223	0.186	PPA4_SCHPO Probable acid phosphatase SPBC4.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4.06 PE=3 SV=1
18	Q38AP9	2.99e-08	57.8	501	0.231	0.178	Q38AP9_TRYB2 Membrane-bound acid phosphatase 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3560 PE=4 SV=1
19	Q9GNS9	3.39e-08	57.4	501	0.231	0.178	Q9GNS9_9TRYP Membrane-bound acid phosphatase 2 OS=Trypanosoma brucei OX=5691 GN=MBAP2 PE=4 SV=1
20	Q38AR1	6.89e-08	56.6	435	0.078	0.069	Q38AR1_TRYB2 Acid phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3720 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00328 His_Phos_2	6.8e-31	119.6	Histidine phosphatase superfamily (branch 2)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323036

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313581	0.818	Kallikrein-2
2	9606.ENSP00000264690	0.815	Plasma kallikrein
3	9606.ENSP00000314508	0.800	Glucosylceramidase that catalyzes, within the lysosomal compartment, the hydrolysis of glucosylceramide/GlcCer into free ceramide and glucose . Thereby, plays a central role in the degradation of complex lipids and the turnover of cellular membranes . Through the production of ceramides, participates to the PKC-activated salvage pathway of ceramide formation . Also plays a role in cholesterol metabolism . May either catalyze the glucosylation of cholesterol, through a transglucosylation reaction that transfers glucose from glucosylceramide to cholesterol . The short chain saturated C8: [...]
4	9606.ENSP00000463092	0.775	Beta-microseminoprotein
5	9606.ENSP00000314151	0.769	Prostate-specific antigen
6	9606.ENSP00000296125	0.765	Protein-glutamine gamma-glutamyltransferase 4
7	9606.ENSP00000274979	0.721	Anoctamin-7
8	9606.ENSP00000356113	0.721	Solute carrier family 45 member 3
9	9606.ENSP00000291009	0.688	Prolactin induced protein
10	9606.ENSP00000378119	0.641	Metalloreductase STEAP2
11	9606.ENSP00000369419	0.620	Metalloreductase STEAP4
12	9606.ENSP00000361965	0.613	Adenosine deaminase
13	9606.ENSP00000286648	0.610	Deoxycytidine kinase
14	9606.ENSP00000309836	0.610	Coiled-coil domain-containing protein 13
15	9606.ENSP00000354532	0.605	Purine nucleoside phosphorylase
16	9606.ENSP00000264990	0.576	Acyl-CoA dehydrogenase family member 11
17	9606.ENSP00000168712	0.571	Fibroblast growth factor 4
18	9606.ENSP00000439012	0.569	Acyl-CoA-binding protein
19	9606.ENSP00000398064	0.565	HIG1 domain family member 1A, mitochondrial
20	9606.ENSP00000257770	0.556	5'-nucleotidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003993	1.000	acid phosphatase activity
GO:0042803	0.985	protein homodimerization activity
GO:0060090	0.374	molecular adaptor activity
GO:0008252	0.356	nucleotidase activity
GO:0043167	0.316	ion binding
GO:0008253	0.311	5'-nucleotidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0008152	0.978	metabolic process
GO:0044237	0.928	cellular metabolic process
GO:0050789	0.881	regulation of biological process
GO:0006796	0.790	phosphate-containing compound metabolic process
GO:0071704	0.748	organic substance metabolic process
GO:0044238	0.693	primary metabolic process
GO:0050794	0.656	regulation of cellular process
GO:0006807	0.612	nitrogen compound metabolic process
GO:1901564	0.585	organonitrogen compound metabolic process
GO:0048518	0.503	positive regulation of biological process
GO:0048522	0.307	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031982	0.999	vesicle
GO:0012505	0.995	endomembrane system
GO:0005576	0.984	extracellular region
GO:0005886	0.976	plasma membrane
GO:0097708	0.950	intracellular vesicle
GO:0005615	0.936	extracellular space
GO:0031410	0.932	cytoplasmic vesicle
GO:0043230	0.927	extracellular organelle
GO:1903561	0.911	extracellular vesicle
GO:0070062	0.882	extracellular exosome
GO:0031090	0.842	organelle membrane
GO:0099503	0.729	secretory vesicle
GO:0030141	0.724	secretory granule
GO:0005773	0.565	vacuole
GO:0000323	0.551	lytic vacuole
GO:0005764	0.515	lysosome
GO:0043233	0.330	organelle lumen
GO:0012506	0.315	vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.2	1.000	acid phosphatase.
RHEA:22140	0.356	a nucleoside 5'-phosphate + H2O = a nucleoside + phosphate
RHEA:12484	0.311	a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate
EC:3.1.3.5	0.311	5'-nucleotidase.

[back to server]