StarFunc result for job id P15382

User Input

>input (129 residues)
MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLG
IMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNT
HLPETKPSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15382	1.000	1.000	8.409E-19	129	1.000	1.000	P15382.pdb.gz	KCNE1_HUMAN Potassium voltage-gated channel subfamily E member 1 OS=Homo sapiens OX=9606 GN=KCNE1 PE=1 SV=1
2	AFDB:P41546	0.165	0.108	2.407	238	0.155	0.084	P41546.pdb.gz	HAC1_YEAST Transcriptional activator HAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HAC1 PE=1 SV=2
3	AFDB:O74372	0.206	0.106	2.775	282	0.155	0.071	O74372.pdb.gz	DUO1_SCHPO DASH complex subunit duo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=duo1 PE=3 SV=2
4	PDB:7mqaSS	0.161	0.075	3.165	350	0.132	0.049	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	AFDB:P40847	0.231	0.130	3.436	254	0.116	0.059	P40847.pdb.gz	SAP1_SCHPO Switch-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sap1 PE=1 SV=2
6	AFDB:Q9Y0V3	0.258	0.275	3.436	117	0.101	0.111	Q9Y0V3.pdb.gz	T10B_DROME Mitochondrial import inner membrane translocase subunit Tim10B OS=Drosophila melanogaster OX=7227 GN=Tim9b PE=3 SV=1
7	AFDB:P43611	0.264	0.084	3.690	510	0.140	0.035	P43611.pdb.gz	OSW7_YEAST Outer spore wall protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OSW7 PE=1 SV=1
8	AFDB:O94414	0.221	0.112	3.962	334	0.155	0.060	O94414.pdb.gz	LNP_SCHPO Endoplasmic reticulum junction formation protein lunapark OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lnp1 PE=1 SV=1
9	AFDB:Q9NQ50	0.156	0.099	3.962	206	0.163	0.102	Q9NQ50.pdb.gz	RM40_HUMAN Large ribosomal subunit protein mL40 OS=Homo sapiens OX=9606 GN=MRPL40 PE=1 SV=1
10	AFDB:A0A0H3K9R3	0.182	0.149	4.568	161	0.147	0.118	A0A0H3K9R3.pdb.gz	RBCX_SYNP6 RuBisCO chaperone RbcX OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) OX=269084 GN=rbcX PE=1 SV=1
11	AFDB:Q7LGC8	0.217	0.063	4.568	479	0.140	0.038	Q7LGC8.pdb.gz	CHST3_HUMAN Carbohydrate sulfotransferase 3 OS=Homo sapiens OX=9606 GN=CHST3 PE=1 SV=3
12	PDB:7egb0	0.174	0.106	6.006	234	0.163	0.090	7egb0.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15382	2.03e-95	272	129	1.000	1.000	KCNE1_HUMAN Potassium voltage-gated channel subfamily E member 1 OS=Homo sapiens OX=9606 GN=KCNE1 PE=1 SV=1
2	Q6FHJ6	1.10e-94	270	129	0.992	0.992	Q6FHJ6_HUMAN Potassium voltage-gated channel subfamily E member 1 (Fragment) OS=Homo sapiens OX=9606 GN=KCNE1 PE=1 SV=1
3	P23299	4.95e-72	213	129	0.760	0.760	KCNE1_MOUSE Potassium voltage-gated channel subfamily E member 1 OS=Mus musculus OX=10090 GN=Kcne1 PE=1 SV=1
4	P15383	1.01e-69	207	130	0.767	0.762	KCNE1_RAT Potassium voltage-gated channel subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Kcne1 PE=1 SV=1
5	Q9Y6J6	6.15e-10	55.1	123	0.178	0.187	KCNE2_HUMAN Potassium voltage-gated channel subfamily E member 2 OS=Homo sapiens OX=9606 GN=KCNE2 PE=1 SV=1
6	P63161	1.23e-08	51.6	123	0.155	0.163	KCNE2_RAT Potassium voltage-gated channel subfamily E member 2 OS=Rattus norvegicus OX=10116 GN=Kcne2 PE=1 SV=1
7	Q9D808	3.29e-08	50.4	123	0.194	0.203	KCNE2_MOUSE Potassium voltage-gated channel subfamily E member 2 OS=Mus musculus OX=10090 GN=Kcne2 PE=1 SV=2
8	Q71FD8	2.06e-04	41.2	170	0.147	0.112	Q71FD8_RAT Potassium voltage-gated channel subfamily E regulatory subunit 4 OS=Rattus norvegicus OX=10116 GN=Kcne4 PE=3 SV=1
9	Q8WWG9	2.69e-04	41.2	221	0.147	0.086	KCNE4_HUMAN Potassium voltage-gated channel subfamily E member 4 OS=Homo sapiens OX=9606 GN=KCNE4 PE=1 SV=4
10	Q2N1I1	0.002	37.4	99	0.109	0.141	Q2N1I1_HUMAN Cardiac voltage-gated potassium channel accessory subunit isoform 3a (Fragment) OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=1
11	Q6IAE6	0.002	37.4	103	0.109	0.136	Q6IAE6_HUMAN KCNE3 protein OS=Homo sapiens OX=9606 GN=KCNE3 PE=2 SV=1
12	Q9Y6H6	0.002	37.4	103	0.109	0.136	KCNE3_HUMAN Potassium voltage-gated channel subfamily E member 3 OS=Homo sapiens OX=9606 GN=KCNE3 PE=1 SV=1
13	Q9JJV7	0.003	37.0	107	0.109	0.131	KCNE3_RAT Potassium voltage-gated channel subfamily E member 3 OS=Rattus norvegicus OX=10116 GN=Kcne3 PE=1 SV=1
14	Q9WTW2	0.003	37.0	103	0.109	0.136	KCNE3_MOUSE Potassium voltage-gated channel subfamily E member 3 OS=Mus musculus OX=10090 GN=Kcne3 PE=3 SV=1
15	Q9UJ90	0.038	34.7	142	0.116	0.106	KCNE5_HUMAN Potassium voltage-gated channel subfamily E regulatory beta subunit 5 OS=Homo sapiens OX=9606 GN=KCNE5 PE=1 SV=1
16	P02816	0.31	32.0	146	0.147	0.130	PIP_MOUSE Prolactin-inducible protein homolog OS=Mus musculus OX=10090 GN=Pip PE=2 SV=3
17	Q5FBC4	0.90	31.2	1400	0.116	0.011	TMCC_DICDI Tiny macrocysts protein C OS=Dictyostelium discoideum OX=44689 GN=tmcC PE=2 SV=1
18	Q5FBC3	1.5	30.8	1416	0.109	0.010	TMCB_DICDI Tiny macrocysts protein B OS=Dictyostelium discoideum OX=44689 GN=tmcB PE=2 SV=1
19	P77293	2.1	30.0	306	0.132	0.056	GTRB_ECOLI Prophage bactoprenol glucosyl transferase homolog OS=Escherichia coli (strain K12) OX=83333 GN=yfdH PE=1 SV=1
20	Q0WP44	2.2	30.0	1202	0.101	0.011	HASTY_ARATH Protein HASTY 1 OS=Arabidopsis thaliana OX=3702 GN=HST1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16319 DUF4958	5.4e+02	9.9	Domain of unknown function (DUF4958)
2	PF02060 ISK_Channel	9.6e-66	230.6	Slow voltage-gated potassium channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337255

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000155840	0.999	Potassium voltage-gated channel subfamily KQT member 1
2	9606.ENSP00000262186	0.993	Potassium voltage-gated channel subfamily H member 2
3	9606.ENSP00000348573	0.969	A-kinase anchor protein 9
4	9606.ENSP00000310557	0.936	Potassium voltage-gated channel subfamily E member 3
5	9606.ENSP00000410257	0.901	Sodium channel protein type 5 subunit alpha
6	9606.ENSP00000262916	0.874	Potassium voltage-gated channel subfamily KQT member 4
7	9606.ENSP00000243457	0.868	Inward rectifier potassium channel 2
8	9606.ENSP00000281830	0.863	Potassium voltage-gated channel subfamily E member 4
9	9606.ENSP00000361173	0.836	Potassium voltage-gated channel subfamily E regulatory beta subunit 5
10	9606.ENSP00000352035	0.833	Potassium voltage-gated channel subfamily KQT member 2
11	9606.ENSP00000309591	0.800	cAMP-dependent protein kinase catalytic subunit alpha
12	9606.ENSP00000359719	0.800	cAMP-dependent protein kinase catalytic subunit beta
13	9606.ENSP00000366488	0.800	cAMP-dependent protein kinase catalytic subunit gamma
14	9606.ENSP00000485125	0.800	annotation not available
15	9606.ENSP00000345055	0.785	Potassium voltage-gated channel subfamily KQT member 5
16	9606.ENSP00000360806	0.785	Potassium voltage-gated channel subfamily B member 1
17	9606.ENSP00000322460	0.754	Sodium channel subunit beta-4
18	9606.ENSP00000319591	0.738	Potassium voltage-gated channel subfamily D member 3
19	9606.ENSP00000252321	0.728	Potassium voltage-gated channel subfamily A member 5
20	9606.ENSP00000266376	0.724	Voltage-dependent L-type calcium channel subunit alpha-1C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015459	1.000	potassium channel regulator activity
GO:0005251	0.997	delayed rectifier potassium channel activity
GO:0008092	0.934	cytoskeletal protein binding
GO:0086008	0.707	voltage-gated potassium channel activity involved in cardiac muscle cell action potential repolarization
GO:1902282	0.640	voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization
GO:0031433	0.600	telethonin binding
GO:0044325	0.361	transmembrane transporter binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0006811	0.985	monoatomic ion transport
GO:0032501	0.980	multicellular organismal process
GO:0050789	0.979	regulation of biological process
GO:0030001	0.970	metal ion transport
GO:0065008	0.963	regulation of biological quality
GO:0071805	0.959	potassium ion transmembrane transport
GO:0050794	0.957	regulation of cellular process
GO:0010959	0.951	regulation of metal ion transport
GO:0061337	0.951	cardiac conduction
GO:0060047	0.949	heart contraction
GO:1904062	0.938	regulation of monoatomic cation transmembrane transport
GO:0050896	0.935	response to stimulus
GO:0002027	0.926	regulation of heart rate
GO:0032409	0.925	regulation of transporter activity
GO:0006941	0.911	striated muscle contraction
GO:0042391	0.908	regulation of membrane potential
GO:0086001	0.897	cardiac muscle cell action potential
GO:0032412	0.896	regulation of monoatomic ion transmembrane transporter activity
GO:1901379	0.890	regulation of potassium ion transmembrane transport
GO:0071320	0.873	cellular response to cAMP
GO:0060048	0.861	cardiac muscle contraction
GO:0051050	0.846	positive regulation of transport
GO:0043271	0.843	negative regulation of monoatomic ion transport
GO:0043267	0.817	negative regulation of potassium ion transport
GO:1901016	0.800	regulation of potassium ion transmembrane transporter activity
GO:0070252	0.779	actin-mediated cell contraction
GO:0034766	0.725	negative regulation of monoatomic ion transmembrane transport
GO:0043270	0.718	positive regulation of monoatomic ion transport
GO:0048522	0.591	positive regulation of cellular process
GO:2001257	0.484	regulation of cation channel activity
GO:1904063	0.463	negative regulation of cation transmembrane transport
GO:0043268	0.410	positive regulation of potassium ion transport
GO:0034767	0.403	positive regulation of monoatomic ion transmembrane transport
GO:0044092	0.402	negative regulation of molecular function
GO:1904064	0.370	positive regulation of cation transmembrane transport
GO:0032410	0.367	negative regulation of transporter activity
GO:2001258	0.359	negative regulation of cation channel activity
GO:1901381	0.309	positive regulation of potassium ion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008076	0.999	voltage-gated potassium channel complex
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0005737	0.986	cytoplasm
GO:0009986	0.539	cell surface
GO:0005764	0.307	lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]