StarFunc result for job id P15391

User Input

>input (556 residues)
MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP
FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE
LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL
NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW
VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL
IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG
LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF
YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS
PHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGP
DPAWGGGGRMGTWSTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15391	1.000	1.000	1.842E-95	556	1.000	1.000	P15391.pdb.gz	CD19_HUMAN B-lymphocyte antigen CD19 OS=Homo sapiens OX=9606 GN=CD19 PE=1 SV=6
2	AFDB:P25918	0.559	0.568	7.782E-63	547	0.660	0.671	P25918.pdb.gz	CD19_MOUSE B-lymphocyte antigen CD19 OS=Mus musculus OX=10090 GN=Cd19 PE=1 SV=3
3	AFDB:O97174	0.077	0.048	1.317E-4	975	0.146	0.083	O97174.pdb.gz	O97174_DROME EG:163A10.1 protein OS=Drosophila melanogaster OX=7227 GN=kirre PE=1 SV=1
4	AFDB:B0CM22	0.080	0.062	5.758E-4	769	0.133	0.096	B0CM22.pdb.gz
5	AFDB:Q08180	0.084	0.063	9.595E-4	764	0.122	0.089	Q08180.pdb.gz	ICCR_DROME Irregular chiasm C-roughest protein OS=Drosophila melanogaster OX=7227 GN=rst PE=1 SV=2
6	AFDB:B9VQL3	0.075	0.075	2.436E-2	565	0.110	0.108	B9VQL3.pdb.gz
7	AFDB:Q91Y13	0.072	0.047	2.436E-2	937	0.133	0.079	Q91Y13.pdb.gz	PCDA7_MOUSE Protocadherin alpha-7 OS=Mus musculus OX=10090 GN=Pcdha7 PE=1 SV=1
8	PDB:6dldD	0.061	0.122	3.474E-2	269	0.054	0.112	6dldD.pdb.gz
9	PDB:6dlfA	0.063	0.126	5.789E-2	236	0.058	0.136	6dlfA.pdb.gz
10	AFDB:Q9Y5I2	0.068	0.044	6.390E-2	948	0.133	0.078	Q9Y5I2.pdb.gz	PCDAA_HUMAN Protocadherin alpha-10 OS=Homo sapiens OX=9606 GN=PCDHA10 PE=2 SV=1
11	AFDB:A0A0R4IBM0	0.058	0.046	6.764E-2	730	0.122	0.093	A0A0R4IBM0.pdb.gz	A0A0R4IBM0_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
12	PDB:6qp7A	0.071	0.065	7.689E-2	620	0.027	0.024	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
13	AFDB:Q9Y5G3	0.069	0.043	8.982E-2	927	0.104	0.063	Q9Y5G3.pdb.gz	PCDGD_HUMAN Protocadherin gamma-B1 OS=Homo sapiens OX=9606 GN=PCDHGB1 PE=1 SV=1
14	PDB:7qpdT	0.082	0.112	1.081E-1	348	0.034	0.055	7qpdT.pdb.gz	Molecular basis of MHC I quality control in the peptide loading complex.
15	PDB:5oj2B	0.092	0.078	1.281E-1	692	0.072	0.058	5oj2B.pdb.gz
16	PDB:6xdsA	0.062	0.070	2.260E-1	485	0.022	0.025	6xdsA.pdb.gz	Development of a robust crystallization platform for immune receptor TREM2 using a crystallization chaperone strategy.
17	PDB:1ehlL	0.076	0.179	2.531E-1	217	0.041	0.106	1ehlL.pdb.gz	Crystal structure of the 64M-2 antibody Fab fragment in complex with a DNA dT(6-4)T photoproduct formed by ultraviolet radiation.
18	PDB:5c6wJ	0.087	0.168	3.361E-1	238	0.070	0.164	5c6wJ.pdb.gz
19	PDB:5hhmI	0.075	0.180	3.361E-1	196	0.022	0.061	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
20	PDB:3u7wL	0.081	0.195	3.558E-1	210	0.023	0.062	3u7wL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15391	0.0	1126	556	1.000	1.000	CD19_HUMAN B-lymphocyte antigen CD19 OS=Homo sapiens OX=9606 GN=CD19 PE=1 SV=6
2	P25918	0.0	691	547	0.662	0.673	CD19_MOUSE B-lymphocyte antigen CD19 OS=Mus musculus OX=10090 GN=Cd19 PE=1 SV=3
3	A6NGQ3	0.050	39.3	8923	0.076	0.005	A6NGQ3_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=OBSCN PE=1 SV=5
4	Q5VST9	0.057	38.9	7968	0.076	0.005	OBSCN_HUMAN Obscurin OS=Homo sapiens OX=9606 GN=OBSCN PE=1 SV=3
5	Q6FIU8	0.32	36.6	4880	0.068	0.008	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1
6	A0A0G2JUP3	0.58	35.8	7329	0.058	0.004	A0A0G2JUP3_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Obscn PE=1 SV=2
7	Q5NV62	0.81	32.7	99	0.043	0.242	Q5NV62_HUMAN V3-4 protein (Fragment) OS=Homo sapiens OX=9606 GN=V3-4 PE=4 SV=1
8	Q24323	0.87	35.0	724	0.043	0.033	SEM2A_DROME Semaphorin-2A OS=Drosophila melanogaster OX=7227 GN=Sema2a PE=1 SV=2
9	A2AAJ9	1.2	34.7	8886	0.067	0.004	OBSCN_MOUSE Obscurin OS=Mus musculus OX=10090 GN=Obscn PE=1 SV=3
10	Q7Z553	1.3	34.3	956	0.045	0.026	MDGA2_HUMAN MAM domain-containing glycosylphosphatidylinositol anchor protein 2 OS=Homo sapiens OX=9606 GN=MDGA2 PE=1 SV=2
11	P60755	1.8	33.9	949	0.045	0.026	MDGA2_MOUSE MAM domain-containing glycosylphosphatidylinositol anchor protein 2 OS=Mus musculus OX=10090 GN=Mdga2 PE=1 SV=1
12	P60756	1.8	33.9	949	0.045	0.026	MDGA2_RAT MAM domain-containing glycosylphosphatidylinositol anchor protein 2 OS=Rattus norvegicus OX=10116 GN=Mdga2 PE=2 SV=1
13	G5EBF1	3.3	33.1	1273	0.076	0.033	SAX3_CAEEL Protein sax-3 OS=Caenorhabditis elegans OX=6239 GN=sax-3 PE=2 SV=1
14	Q12019	5.1	32.7	4910	0.052	0.006	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
15	Q9VMN9	5.8	32.0	450	0.045	0.056	Q9VMN9_DROME Dpr-interacting protein eta, isoform B OS=Drosophila melanogaster OX=7227 GN=DIP-eta PE=1 SV=4
16	Q8K4F0	7.4	31.6	333	0.050	0.084	CD226_MOUSE CD226 antigen OS=Mus musculus OX=10090 GN=Cd226 PE=1 SV=1
17	Q9P121	9.5	31.2	344	0.036	0.058	NTRI_HUMAN Neurotrimin OS=Homo sapiens OX=9606 GN=NTM PE=1 SV=1
18	Q6WRI0	9.7	31.6	2623	0.061	0.013	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	0.73	21.4	Immunoglobulin domain
2	PF13895 Ig_2	0.19	23.4	Immunoglobulin domain
3	PF13927 Ig_3	0.0073	28.2	Immunoglobulin domain
4	PF07686 V-set	0.0075	27.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437940

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263645	0.999	CD81 antigen
2	9606.ENSP00000356024	0.999	Complement receptor type 2
3	9606.ENSP00000428924	0.999	Tyrosine-protein kinase Lyn
4	9606.ENSP00000472929	0.999	Proto-oncogene vav
5	9606.ENSP00000221972	0.998	B-cell antigen receptor complex-associated protein alpha chain
6	9606.ENSP00000376544	0.997	B-cell antigen receptor complex-associated protein beta chain
7	9606.ENSP00000428056	0.988	Phosphatidylinositol 3-kinase regulatory subunit alpha
8	9606.ENSP00000364907	0.984	Tyrosine-protein kinase SYK
9	9606.ENSP00000386187	0.976	Interferon-induced transmembrane protein 1
10	9606.ENSP00000263967	0.968	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
11	9606.ENSP00000384371	0.967	B-cell lymphoma 6 protein
12	9606.ENSP00000451828	0.958	RAC-alpha serine/threonine-protein kinase
13	9606.ENSP00000360916	0.956	Guanine nucleotide exchange factor VAV2
14	9606.ENSP00000366563	0.954	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
15	9606.ENSP00000227155	0.949	CD82 antigen
16	9606.ENSP00000376345	0.946	Growth factor receptor-bound protein 2
17	9606.ENSP00000411355	0.927	Receptor-type tyrosine-protein phosphatase C
18	9606.ENSP00000303507	0.925	Breakpoint cluster region protein
19	9606.ENSP00000085219	0.922	B-cell receptor CD22
20	9606.ENSP00000011653	0.918	T-cell surface glycoprotein CD4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060089	0.935	molecular transducer activity
GO:0038023	0.914	signaling receptor activity
GO:0004888	0.506	transmembrane signaling receptor activity
GO:0042802	0.415	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0009987	0.993	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0051716	0.982	cellular response to stimulus
GO:0007154	0.980	cell communication
GO:0048522	0.979	positive regulation of cellular process
GO:0023052	0.976	signaling
GO:0007165	0.970	signal transduction
GO:0019222	0.966	regulation of metabolic process
GO:0032501	0.935	multicellular organismal process
GO:0048583	0.926	regulation of response to stimulus
GO:0009893	0.916	positive regulation of metabolic process
GO:0009966	0.914	regulation of signal transduction
GO:0080090	0.913	regulation of primary metabolic process
GO:0031323	0.912	regulation of cellular metabolic process
GO:0002376	0.905	immune system process
GO:0051239	0.904	regulation of multicellular organismal process
GO:0065009	0.902	regulation of molecular function
GO:0031325	0.899	positive regulation of cellular metabolic process
GO:0006955	0.895	immune response
GO:0048584	0.892	positive regulation of response to stimulus
GO:0007166	0.892	cell surface receptor signaling pathway
GO:0002684	0.891	positive regulation of immune system process
GO:0043085	0.872	positive regulation of catalytic activity
GO:0042327	0.856	positive regulation of phosphorylation
GO:0050778	0.841	positive regulation of immune response
GO:0046649	0.833	lymphocyte activation
GO:0032879	0.828	regulation of localization
GO:0051049	0.802	regulation of transport
GO:0051347	0.796	positive regulation of transferase activity
GO:0050865	0.795	regulation of cell activation
GO:0042113	0.793	B cell activation
GO:0033674	0.791	positive regulation of kinase activity
GO:0051282	0.790	regulation of sequestering of calcium ion
GO:0002443	0.786	leukocyte mediated immunity
GO:0051924	0.785	regulation of calcium ion transport
GO:0051050	0.776	positive regulation of transport
GO:0002757	0.775	immune response-activating signaling pathway
GO:0002250	0.773	adaptive immune response
GO:1904064	0.768	positive regulation of cation transmembrane transport
GO:1903169	0.767	regulation of calcium ion transmembrane transport
GO:0002429	0.767	immune response-activating cell surface receptor signaling pathway
GO:0051928	0.760	positive regulation of calcium ion transport
GO:0050851	0.757	antigen receptor-mediated signaling pathway
GO:0051281	0.738	positive regulation of release of sequestered calcium ion into cytosol
GO:0002694	0.713	regulation of leukocyte activation
GO:0002449	0.645	lymphocyte mediated immunity
GO:0002460	0.617	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0045834	0.610	positive regulation of lipid metabolic process
GO:0019724	0.602	B cell mediated immunity
GO:0050854	0.598	regulation of antigen receptor-mediated signaling pathway
GO:0043550	0.595	regulation of lipid kinase activity
GO:0043551	0.583	regulation of phosphatidylinositol 3-kinase activity
GO:0051249	0.546	regulation of lymphocyte activation
GO:0060255	0.523	regulation of macromolecule metabolic process
GO:0048856	0.435	anatomical structure development
GO:0002366	0.390	leukocyte activation involved in immune response
GO:0010604	0.375	positive regulation of macromolecule metabolic process
GO:0002285	0.365	lymphocyte activation involved in immune response
GO:0051171	0.359	regulation of nitrogen compound metabolic process
GO:0070661	0.336	leukocyte proliferation
GO:0050853	0.335	B cell receptor signaling pathway
GO:0046651	0.330	lymphocyte proliferation
GO:0002312	0.326	B cell activation involved in immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009897	0.999	external side of plasma membrane
GO:0032991	0.997	protein-containing complex
GO:0043227	0.997	membrane-bounded organelle
GO:0005576	0.991	extracellular region
GO:0005615	0.974	extracellular space
GO:0031982	0.973	vesicle
GO:0043230	0.949	extracellular organelle
GO:0070062	0.918	extracellular exosome
GO:0043231	0.813	intracellular membrane-bounded organelle
GO:0005737	0.668	cytoplasm
GO:0012505	0.388	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]