StarFunc result for job id P15407

User Input

>input (271 residues)
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLG
PSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAA
KCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKE
GDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPST
PEPCASAHRKSSSSSGDPSSDPLGSPTLLAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10158	0.589	0.582	2.452E-31	275	0.915	0.902	P10158.pdb.gz	FOSL1_RAT Fos-related antigen 1 OS=Rattus norvegicus OX=10116 GN=Fosl1 PE=2 SV=1
2	AFDB:P15408	0.351	0.301	6.600E-13	326	0.542	0.451	P15408.pdb.gz	FOSL2_HUMAN Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1
3	AFDB:A2RUX8	0.365	0.296	1.217E-11	341	0.498	0.396	A2RUX8.pdb.gz	A2RUX8_DANRE FOS-like 2, AP-1 transcription factor subunit OS=Danio rerio OX=7955 GN=zgc:158347 PE=2 SV=1
4	AFDB:P01100	0.327	0.240	2.090E-10	380	0.498	0.355	P01100.pdb.gz	FOS_HUMAN Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
5	AFDB:Q4ZJF0	0.353	0.279	9.299E-10	349	0.461	0.358	Q4ZJF0.pdb.gz
6	AFDB:A8MPH9	0.305	0.126	6.634E-3	722	0.244	0.091	A8MPH9.pdb.gz	FOSLD_DROME Transcription factor kayak, isoforms D/sro OS=Drosophila melanogaster OX=7227 GN=kay PE=1 SV=2
7	AFDB:Q8R1H8	0.296	0.290	1.514E-1	277	0.173	0.170	Q8R1H8.pdb.gz	BATF2_MOUSE Basic leucine zipper transcriptional factor ATF-like 2 OS=Mus musculus OX=10090 GN=Batf2 PE=2 SV=1
8	AFDB:Q84JK2	0.193	0.185	3.553E-1	285	0.137	0.130	Q84JK2.pdb.gz	FD_ARATH Protein FD OS=Arabidopsis thaliana OX=3702 GN=FD PE=1 SV=1
9	AFDB:Q2L4Q5	0.263	0.221	5.843E-1	327	0.177	0.147	Q2L4Q5.pdb.gz	Q2L4Q5_ONCMY Transcription factor AP-1 OS=Oncorhynchus mykiss OX=8022 GN=jun PE=2 SV=1
10	AFDB:P05627	0.262	0.216	7.232E-1	334	0.155	0.126	P05627.pdb.gz	JUN_MOUSE Transcription factor Jun OS=Mus musculus OX=10090 GN=Jun PE=1 SV=3
11	PDB:7r5jV0	0.117	0.116	7.460	273	0.070	0.070	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:6qx91K	0.079	0.105	9.914	201	0.074	0.100	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
13	PDB:7mqaNA	0.135	0.126	9.914	295	0.063	0.058	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z595	0.0	541	271	1.000	1.000	A0A0S2Z595_HUMAN FOS-like antigen 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FOSL1 PE=2 SV=1
2	P15407	0.0	541	271	1.000	1.000	FOSL1_HUMAN Fos-related antigen 1 OS=Homo sapiens OX=9606 GN=FOSL1 PE=1 SV=1
3	E9PPX2	5.05e-162	451	235	0.867	1.000	E9PPX2_HUMAN FOS like 1, AP-1 transcription factor subunit OS=Homo sapiens OX=9606 GN=FOSL1 PE=1 SV=1
4	P10158	9.68e-143	403	275	0.900	0.887	FOSL1_RAT Fos-related antigen 1 OS=Rattus norvegicus OX=10116 GN=Fosl1 PE=2 SV=1
5	P48755	3.53e-130	371	273	0.886	0.879	FOSL1_MOUSE Fos-related antigen 1 OS=Mus musculus OX=10090 GN=Fosl1 PE=1 SV=2
6	E9PKL5	2.19e-66	204	135	0.399	0.800	E9PKL5_HUMAN FOS like 1, AP-1 transcription factor subunit OS=Homo sapiens OX=9606 GN=FOSL1 PE=1 SV=1
7	P51145	4.29e-49	166	326	0.554	0.460	FOSL2_RAT Fos-related antigen 2 OS=Rattus norvegicus OX=10116 GN=Fosl2 PE=1 SV=2
8	P15408	7.45e-48	163	326	0.554	0.460	FOSL2_HUMAN Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1
9	P47930	8.51e-47	160	326	0.550	0.457	FOSL2_MOUSE Fos-related antigen 2 OS=Mus musculus OX=10090 GN=Fosl2 PE=1 SV=2
10	Q6P0S4	3.82e-46	159	349	0.317	0.246	Q6P0S4_DANRE Proto-oncogene c-Fos OS=Danio rerio OX=7955 GN=fos PE=2 SV=1
11	A2RUX8	8.56e-41	145	341	0.476	0.378	A2RUX8_DANRE FOS-like 2, AP-1 transcription factor subunit OS=Danio rerio OX=7955 GN=zgc:158347 PE=2 SV=1
12	C9JCN8	1.21e-36	130	202	0.328	0.441	C9JCN8_HUMAN FOS like 2, AP-1 transcription factor subunit (Fragment) OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1
13	P01100	2.30e-33	127	380	0.292	0.208	FOS_HUMAN Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
14	Q6FG41	2.30e-33	127	380	0.292	0.208	Q6FG41_HUMAN FOS protein OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
15	P01101	3.99e-33	126	380	0.288	0.205	FOS_MOUSE Protein c-Fos OS=Mus musculus OX=10090 GN=Fos PE=1 SV=1
16	P12841	4.71e-33	126	380	0.299	0.213	FOS_RAT Protein c-Fos OS=Rattus norvegicus OX=10116 GN=Fos PE=1 SV=1
17	H0ZPP9	4.55e-32	122	335	0.310	0.251	H0ZPP9_TAEGU Fos proto-oncogene, AP-1 transcription factor subunit OS=Taeniopygia guttata OX=59729 GN=FOS PE=4 SV=2
18	Q4H3J9	4.11e-26	108	501	0.207	0.112	Q4H3J9_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-Fos PE=1 SV=1
19	D3ZLB7	2.42e-21	93.6	338	0.321	0.257	FOSB_RAT Protein FosB OS=Rattus norvegicus OX=10116 GN=Fosb PE=1 SV=1
20	P13346	2.60e-21	93.6	338	0.321	0.257	FOSB_MOUSE Protein FosB OS=Mus musculus OX=10090 GN=Fosb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	0.00068	31.0	bZIP transcription factor
2	PF07716 bZIP_2	0.13	23.7	Basic region leucine zipper
3	PF03131 bZIP_Maf	0.17	23.8	bZIP Maf transcription factor
4	PF11932 DUF3450	38	15.1	Protein of unknown function (DUF3450)
5	PF15030 DUF4527	2e+02	12.8	Protein of unknown function (DUF4527)
6	PF09726 Macoilin	3.2e+02	11.3	Macoilin family
7	PF16735 MYO10_CC	1.4e+02	14.0	Unconventional myosin-X coiled coil domain
8	PF14992 TMCO5	4e+02	11.9	TMCO5 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310170

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252818	0.999	Transcription factor jun-D
2	9606.ENSP00000303315	0.999	Transcription factor jun-B
3	9606.ENSP00000360266	0.999	Transcription factor AP-1
4	9606.ENSP00000263253	0.971	Histone acetyltransferase p300
5	9606.ENSP00000222305	0.968	Upstream stimulatory factor 2
6	9606.ENSP00000379330	0.952	Nuclear factor of activated T-cells, cytoplasmic 2
7	9606.ENSP00000357000	0.940	Upstream stimulatory factor 1
8	9606.ENSP00000389377	0.929	Nuclear factor of activated T-cells, cytoplasmic 1
9	9606.ENSP00000329357	0.924	Transcription factor Sp1
10	9606.ENSP00000300659	0.923	Nuclear factor of activated T-cells, cytoplasmic 3
11	9606.ENSP00000369465	0.923	Gamma-taxilin
12	9606.ENSP00000306245	0.914	Proto-oncogene c-Fos
13	9606.ENSP00000349022	0.903	Activity-regulated cytoskeleton-associated protein
14	9606.ENSP00000239938	0.877	Early growth response protein 1
15	9606.ENSP00000245919	0.838	Protein fosB
16	9606.ENSP00000264716	0.827	Fos-related antigen 2
17	9606.ENSP00000387699	0.824	Cyclic AMP-responsive element-binding protein 1
18	9606.ENSP00000378974	0.812	Mitogen-activated protein kinase 8
19	9606.ENSP00000242480	0.809	E3 SUMO-protein ligase EGR2
20	9606.ENSP00000318057	0.788	Early growth response protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.996	protein binding
GO:0001228	0.985	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0010604	0.992	positive regulation of macromolecule metabolic process
GO:0045935	0.989	positive regulation of nucleobase-containing compound metabolic process
GO:0010468	0.983	regulation of gene expression
GO:0051254	0.982	positive regulation of RNA metabolic process
GO:0009891	0.980	positive regulation of biosynthetic process
GO:1902680	0.969	positive regulation of RNA biosynthetic process
GO:0042221	0.947	response to chemical
GO:0032501	0.942	multicellular organismal process
GO:0006357	0.935	regulation of transcription by RNA polymerase II
GO:0045893	0.922	positive regulation of DNA-templated transcription
GO:0009987	0.903	cellular process
GO:0006950	0.885	response to stress
GO:0051716	0.871	cellular response to stimulus
GO:0048519	0.846	negative regulation of biological process
GO:0048523	0.808	negative regulation of cellular process
GO:0009605	0.773	response to external stimulus
GO:0045944	0.710	positive regulation of transcription by RNA polymerase II
GO:0007154	0.661	cell communication
GO:0032502	0.624	developmental process
GO:0048856	0.596	anatomical structure development
GO:0007165	0.557	signal transduction
GO:0010033	0.532	response to organic substance
GO:0008152	0.521	metabolic process
GO:0071704	0.494	organic substance metabolic process
GO:0042127	0.493	regulation of cell population proliferation
GO:0065009	0.485	regulation of molecular function
GO:0044237	0.476	cellular metabolic process
GO:0044238	0.472	primary metabolic process
GO:0006807	0.411	nitrogen compound metabolic process
GO:0009892	0.400	negative regulation of metabolic process
GO:0051172	0.393	negative regulation of nitrogen compound metabolic process
GO:0070887	0.391	cellular response to chemical stimulus
GO:0010605	0.389	negative regulation of macromolecule metabolic process
GO:0009719	0.386	response to endogenous stimulus
GO:0043067	0.366	regulation of programmed cell death
GO:0043170	0.352	macromolecule metabolic process
GO:0007275	0.341	multicellular organism development
GO:0009628	0.329	response to abiotic stimulus
GO:0042981	0.326	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.539	protein-containing complex
GO:0005737	0.502	cytoplasm
GO:0005667	0.473	transcription regulator complex
GO:0140513	0.411	nuclear protein-containing complex
GO:0043005	0.377	neuron projection
GO:0042734	0.372	presynaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]