StarFunc result for job id P15408

User Input

>input (326 residues)
MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDL
QWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS
PEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKL
EFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDK
AQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESC
SKAHRRSSSSGDQSSDSLNSPTLLAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4ZJF0	0.270	0.253	1.847E-13	349	0.460	0.430	Q4ZJF0.pdb.gz
2	AFDB:A0A024R0P6	0.289	0.279	6.576E-11	338	0.451	0.435	A0A024R0P6.pdb.gz
3	AFDB:Q4H3J9	0.245	0.161	9.971E-7	501	0.405	0.263	Q4H3J9.pdb.gz	Q4H3J9_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-Fos PE=1 SV=1
4	AFDB:A8MPH9	0.261	0.124	2.968E-3	722	0.230	0.104	A8MPH9.pdb.gz	FOSLD_DROME Transcription factor kayak, isoforms D/sro OS=Drosophila melanogaster OX=7227 GN=kay PE=1 SV=2
5	AFDB:Q8N1L9	0.230	0.271	7.449E-3	274	0.147	0.175	Q8N1L9.pdb.gz	BATF2_HUMAN Basic leucine zipper transcriptional factor ATF-like 2 OS=Homo sapiens OX=9606 GN=BATF2 PE=1 SV=1
6	AFDB:Q8R1H8	0.220	0.257	6.684E-2	277	0.172	0.202	Q8R1H8.pdb.gz	BATF2_MOUSE Basic leucine zipper transcriptional factor ATF-like 2 OS=Mus musculus OX=10090 GN=Batf2 PE=2 SV=1
7	AFDB:O43889	0.172	0.157	8.266E-2	371	0.156	0.137	O43889.pdb.gz	CREB3_HUMAN Cyclic AMP-responsive element-binding protein 3 OS=Homo sapiens OX=9606 GN=CREB3 PE=1 SV=2
8	AFDB:A0A1D8PFV7	0.077	0.046	8.872E-2	660	0.141	0.070	A0A1D8PFV7.pdb.gz	A0A1D8PFV7_CANAL Mdg1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MDG1 PE=4 SV=1
9	AFDB:Q96II8	0.097	0.050	8.872E-2	777	0.132	0.055	Q96II8.pdb.gz	LRCH3_HUMAN DISP complex protein LRCH3 OS=Homo sapiens OX=9606 GN=LRCH3 PE=1 SV=2
10	AFDB:O62090	0.102	0.066	1.357E-1	586	0.181	0.101	O62090.pdb.gz	PRY1_CAEEL Axin-like protein pry-1 OS=Caenorhabditis elegans OX=6239 GN=pry-1 PE=1 SV=2
11	PDB:7mqaNA	0.095	0.101	2.113	295	0.071	0.078	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:6n7pA	0.076	0.131	8.702	186	0.058	0.102	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15408	0.0	659	326	1.000	1.000	FOSL2_HUMAN Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1
2	P47930	0.0	529	326	0.951	0.951	FOSL2_MOUSE Fos-related antigen 2 OS=Mus musculus OX=10090 GN=Fosl2 PE=1 SV=2
3	P51145	0.0	554	326	0.957	0.957	FOSL2_RAT Fos-related antigen 2 OS=Rattus norvegicus OX=10116 GN=Fosl2 PE=1 SV=2
4	C9JCN8	1.08e-144	408	202	0.620	1.000	C9JCN8_HUMAN FOS like 2, AP-1 transcription factor subunit (Fragment) OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1
5	A2RUX8	4.86e-115	338	341	0.690	0.660	A2RUX8_DANRE FOS-like 2, AP-1 transcription factor subunit OS=Danio rerio OX=7955 GN=zgc:158347 PE=2 SV=1
6	P12841	2.24e-61	202	380	0.512	0.439	FOS_RAT Protein c-Fos OS=Rattus norvegicus OX=10116 GN=Fos PE=1 SV=1
7	P01101	9.00e-61	200	380	0.512	0.439	FOS_MOUSE Protein c-Fos OS=Mus musculus OX=10090 GN=Fos PE=1 SV=1
8	Q6P0S4	4.96e-60	197	349	0.466	0.436	Q6P0S4_DANRE Proto-oncogene c-Fos OS=Danio rerio OX=7955 GN=fos PE=2 SV=1
9	P01100	7.25e-60	198	380	0.488	0.418	FOS_HUMAN Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
10	Q6FG41	7.25e-60	198	380	0.488	0.418	Q6FG41_HUMAN FOS protein OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
11	H0ZPP9	2.07e-53	180	335	0.359	0.349	H0ZPP9_TAEGU Fos proto-oncogene, AP-1 transcription factor subunit OS=Taeniopygia guttata OX=59729 GN=FOS PE=4 SV=2
12	A0A0S2Z595	1.32e-51	173	271	0.429	0.517	A0A0S2Z595_HUMAN FOS-like antigen 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FOSL1 PE=2 SV=1
13	P15407	1.32e-51	173	271	0.429	0.517	FOSL1_HUMAN Fos-related antigen 1 OS=Homo sapiens OX=9606 GN=FOSL1 PE=1 SV=1
14	P10158	4.42e-51	172	275	0.423	0.502	FOSL1_RAT Fos-related antigen 1 OS=Rattus norvegicus OX=10116 GN=Fosl1 PE=2 SV=1
15	P48755	8.72e-44	153	273	0.411	0.491	FOSL1_MOUSE Fos-related antigen 1 OS=Mus musculus OX=10090 GN=Fosl1 PE=1 SV=2
16	P13346	1.76e-36	135	338	0.479	0.462	FOSB_MOUSE Protein FosB OS=Mus musculus OX=10090 GN=Fosb PE=1 SV=1
17	D3ZLB7	2.15e-36	135	338	0.479	0.462	FOSB_RAT Protein FosB OS=Rattus norvegicus OX=10116 GN=Fosb PE=1 SV=1
18	E9PPX2	2.04e-31	119	235	0.331	0.460	E9PPX2_HUMAN FOS like 1, AP-1 transcription factor subunit OS=Homo sapiens OX=9606 GN=FOSL1 PE=1 SV=1
19	Q4H3J9	6.52e-29	118	501	0.169	0.110	Q4H3J9_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-Fos PE=1 SV=1
20	P53539	5.72e-25	105	338	0.273	0.263	FOSB_HUMAN Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	1.6e-05	36.2	bZIP transcription factor
2	PF07716 bZIP_2	0.013	26.8	Basic region leucine zipper
3	PF03131 bZIP_Maf	0.053	25.4	bZIP Maf transcription factor
4	PF15030 DUF4527	4.4e+02	11.6	Protein of unknown function (DUF4527)
5	PF06785 UPF0242	5.4e+02	12.0	Uncharacterised protein family (UPF0242) N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264716

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252818	0.999	Transcription factor jun-D
2	9606.ENSP00000303315	0.999	Transcription factor jun-B
3	9606.ENSP00000360266	0.999	Transcription factor AP-1
4	9606.ENSP00000357633	0.976	Glutaredoxin-3
5	9606.ENSP00000336790	0.919	Cyclic AMP-dependent transcription factor ATF-4
6	9606.ENSP00000306245	0.911	Proto-oncogene c-Fos
7	9606.ENSP00000399465	0.895	Cyclic AMP-dependent transcription factor ATF-7
8	9606.ENSP00000362222	0.870	Serine/threonine-protein kinase 40
9	9606.ENSP00000245919	0.833	Protein fosB
10	9606.ENSP00000310170	0.827	Fos-related antigen 1
11	9606.ENSP00000350359	0.805	Cyclic AMP-responsive element-binding protein 5
12	9606.ENSP00000378974	0.801	Mitogen-activated protein kinase 8
13	9606.ENSP00000264110	0.792	Cyclic AMP-dependent transcription factor ATF-2
14	9606.ENSP00000312150	0.785	Tribbles homolog 1
15	9606.ENSP00000229795	0.782	Mitogen-activated protein kinase 14
16	9606.ENSP00000239938	0.760	Early growth response protein 1
17	9606.ENSP00000394560	0.759	Mitogen-activated protein kinase 9
18	9606.ENSP00000333685	0.757	Mitogen-activated protein kinase 11
19	9606.ENSP00000215659	0.747	Mitogen-activated protein kinase 12
20	9606.ENSP00000387699	0.747	Cyclic AMP-responsive element-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0000977	0.856	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.705	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001216	0.502	DNA-binding transcription activator activity
GO:0001228	0.331	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.997	regulation of DNA-templated transcription
GO:0051173	0.995	positive regulation of nitrogen compound metabolic process
GO:0010604	0.995	positive regulation of macromolecule metabolic process
GO:0031325	0.995	positive regulation of cellular metabolic process
GO:0045893	0.993	positive regulation of DNA-templated transcription
GO:0009987	0.985	cellular process
GO:0006357	0.944	regulation of transcription by RNA polymerase II
GO:0050896	0.886	response to stimulus
GO:0045944	0.752	positive regulation of transcription by RNA polymerase II
GO:0051716	0.613	cellular response to stimulus
GO:0071704	0.509	organic substance metabolic process
GO:0044238	0.498	primary metabolic process
GO:0044237	0.483	cellular metabolic process
GO:0048519	0.463	negative regulation of biological process
GO:0006950	0.460	response to stress
GO:0006807	0.457	nitrogen compound metabolic process
GO:0043170	0.411	macromolecule metabolic process
GO:0042221	0.406	response to chemical
GO:0007154	0.383	cell communication
GO:0032502	0.368	developmental process
GO:0032501	0.350	multicellular organismal process
GO:0048856	0.346	anatomical structure development
GO:0048523	0.321	negative regulation of cellular process
GO:0023052	0.318	signaling
GO:0070887	0.309	cellular response to chemical stimulus
GO:0007165	0.302	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.985	nuclear lumen
GO:0005654	0.984	nucleoplasm
GO:0032991	0.710	protein-containing complex
GO:0005667	0.699	transcription regulator complex
GO:0140513	0.535	nuclear protein-containing complex
GO:0090575	0.511	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]