StarFunc result for job id P15498

User Input

>input (845 residues)
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVF
QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED
YSEYC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15498	1.000	1.000	0.000	845	1.000	1.000	P15498.pdb.gz	VAV_HUMAN Proto-oncogene vav OS=Homo sapiens OX=9606 GN=VAV1 PE=1 SV=4
2	AFDB:Q9R0C8	0.662	0.660	2.805E-90	847	0.588	0.587	Q9R0C8.pdb.gz	VAV3_MOUSE Guanine nucleotide exchange factor VAV3 OS=Mus musculus OX=10090 GN=Vav3 PE=1 SV=2
3	AFDB:P52735	0.652	0.628	4.719E-83	878	0.516	0.497	P52735.pdb.gz	VAV2_HUMAN Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2 PE=1 SV=2
4	AFDB:Q9NHV9	0.581	0.617	2.449E-55	793	0.318	0.339	Q9NHV9.pdb.gz	VAV_DROME Protein vav OS=Drosophila melanogaster OX=7227 GN=Vav PE=1 SV=2
5	AFDB:Q45FX5	0.601	0.509	9.015E-53	1007	0.307	0.257	Q45FX5.pdb.gz	VAV_CAEEL Protein vav-1 OS=Caenorhabditis elegans OX=6239 GN=vav-1 PE=1 SV=1
6	AFDB:O15068	0.251	0.196	2.333E-19	1137	0.146	0.108	O15068.pdb.gz	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
7	AFDB:Q6PDM6	0.245	0.189	6.068E-19	1166	0.162	0.117	Q6PDM6.pdb.gz	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
8	AFDB:Q63406	0.244	0.190	7.219E-19	1149	0.143	0.105	Q63406.pdb.gz	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3
9	AFDB:A0A2R8RYT7	0.221	0.257	3.302E-18	693	0.108	0.131	A0A2R8RYT7.pdb.gz
10	AFDB:Q9ES28	0.237	0.234	5.809E-18	862	0.189	0.186	Q9ES28.pdb.gz	ARHG7_MOUSE Rho guanine nucleotide exchange factor 7 OS=Mus musculus OX=10090 GN=Arhgef7 PE=1 SV=2
11	PDB:4mt6A	0.278	0.522	9.512E-16	389	0.088	0.190	4mt6A.pdb.gz
12	PDB:7rx9A	0.206	0.395	2.818E-15	432	0.110	0.215	7rx9A.pdb.gz
13	PDB:1griA	0.108	0.406	2.267E-12	211	0.071	0.284	1griA.pdb.gz
14	PDB:2h8hA	0.112	0.205	1.036E-8	445	0.059	0.112	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:4gouA	0.204	0.324	1.036E-8	507	0.072	0.120	4gouA.pdb.gz
16	PDB:1k9aB	0.109	0.204	1.082E-8	441	0.053	0.102	1k9aB.pdb.gz
17	PDB:3qwyA	0.095	0.430	5.641E-8	170	0.045	0.224	3qwyA.pdb.gz
18	PDB:2lqnA	0.101	0.267	1.082E-7	303	0.060	0.168	2lqnA.pdb.gz
19	PDB:2eyzA	0.094	0.238	8.708E-6	304	0.060	0.168	2eyzA.pdb.gz
20	PDB:6bbpA	0.102	0.162	1.531E-4	520	0.052	0.085	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15498	0.0	1768	845	1.000	1.000	VAV_HUMAN Proto-oncogene vav OS=Homo sapiens OX=9606 GN=VAV1 PE=1 SV=4
2	P27870	0.0	1616	845	0.931	0.931	VAV_MOUSE Proto-oncogene vav OS=Mus musculus OX=10090 GN=Vav1 PE=1 SV=1
3	P52735	0.0	859	878	0.521	0.501	VAV2_HUMAN Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2 PE=1 SV=2
4	P54100	0.0	1604	843	0.929	0.931	VAV_RAT Proto-oncogene vav OS=Rattus norvegicus OX=10116 GN=Vav1 PE=2 SV=1
5	Q60992	0.0	875	868	0.528	0.514	VAV2_MOUSE Guanine nucleotide exchange factor VAV2 OS=Mus musculus OX=10090 GN=Vav2 PE=1 SV=1
6	Q96D37	0.0	1622	790	0.920	0.984	Q96D37_HUMAN VAV1 protein OS=Homo sapiens OX=9606 GN=VAV1 PE=1 SV=2
7	Q9R0C8	0.0	1026	847	0.589	0.588	VAV3_MOUSE Guanine nucleotide exchange factor VAV3 OS=Mus musculus OX=10090 GN=Vav3 PE=1 SV=2
8	Q9UKW4	0.0	1026	847	0.589	0.588	VAV3_HUMAN Guanine nucleotide exchange factor VAV3 OS=Homo sapiens OX=9606 GN=VAV3 PE=1 SV=1
9	Q9NHV9	1.71e-110	358	793	0.256	0.272	VAV_DROME Protein vav OS=Drosophila melanogaster OX=7227 GN=Vav PE=1 SV=2
10	Q45FX5	3.47e-102	341	1007	0.333	0.279	VAV_CAEEL Protein vav-1 OS=Caenorhabditis elegans OX=6239 GN=vav-1 PE=1 SV=1
11	Q13588	5.58e-28	114	217	0.091	0.355	GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens OX=9606 GN=GRAP PE=1 SV=1
12	A1L390	1.05e-22	107	1219	0.107	0.074	PKHG3_HUMAN Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3 PE=1 SV=1
13	D3ZS72	4.29e-21	102	1635	0.095	0.049	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
14	A0A8I6GLR6	4.68e-21	102	1646	0.095	0.049	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
15	Q69ZK0	4.89e-21	102	1650	0.092	0.047	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
16	Q9NR80	1.10e-20	99.8	690	0.105	0.129	ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=ARHGEF4 PE=1 SV=3
17	Q6GPJ9	1.40e-20	93.6	229	0.075	0.275	GRB2B_XENLA Growth factor receptor-bound protein 2-B OS=Xenopus laevis OX=8355 GN=grb2-b PE=1 SV=1
18	Q60631	2.48e-20	92.4	217	0.072	0.281	GRB2_MOUSE Growth factor receptor-bound protein 2 OS=Mus musculus OX=10090 GN=Grb2 PE=1 SV=1
19	B0LPF3	3.18e-20	92.4	217	0.072	0.281	B0LPF3_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2 PE=2 SV=1
20	G1SR27	3.18e-20	92.4	217	0.072	0.281	G1SR27_RABIT Growth factor receptor bound protein 2 OS=Oryctolagus cuniculus OX=9986 GN=GRB2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	1.5e-07	42.5	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	1.8	20.3	C1 domain
3	PF11971 CAMSAP_CH	8.1e-19	78.5	CAMSAP CH domain
4	PF06395 CDC24	0.13	23.9	CDC24 Calponin
5	PF00307 CH	7.4e-18	76.1	Calponin homology (CH) domain
6	PF11302 DUF3104	9.7	17.2	Protein of unknown function (DUF3104)
7	PF18517 LZ3wCH	13	17.3	Leucine zipper with capping helix domain
8	PF00169 PH	1.3e-05	37.0	PH domain
9	PF00621 RhoGEF	7.9e-39	145.3	RhoGEF domain
10	PF00017 SH2	3.5e-14	64.0	SH2 domain
11	PF00018 SH3_1	2.6e-22	89.5	SH3 domain
12	PF07653 SH3_2	2.6e-19	80.1	Variant SH3 domain
13	PF14604 SH3_9	4e-14	63.6	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000472929

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000046794	0.999	Lymphocyte cytosolic protein 2
2	9606.ENSP00000264033	0.999	E3 ubiquitin-protein ligase CBL
3	9606.ENSP00000264972	0.999	Tyrosine-protein kinase ZAP-70
4	9606.ENSP00000364907	0.999	Tyrosine-protein kinase SYK
5	9606.ENSP00000437940	0.999	B-lymphocyte antigen CD19
6	9606.ENSP00000383118	0.997	Cell division control protein 42 homolog
7	9606.ENSP00000398655	0.996	Tyrosine-protein kinase ITK/TSK
8	9606.ENSP00000320147	0.995	Histone-lysine N-methyltransferase EZH2
9	9606.ENSP00000348461	0.995	Ras-related C3 botulinum toxin substrate 1
10	9606.ENSP00000365891	0.995	Wiskott-Aldrich syndrome protein
11	9606.ENSP00000400175	0.995	Transforming protein RhoA
12	9606.ENSP00000422168	0.995	SH3 domain-binding protein 2
13	9606.ENSP00000224337	0.993	B-cell linker protein
14	9606.ENSP00000329418	0.993	Suppressor of cytokine signaling 1
15	9606.ENSP00000337825	0.991	Tyrosine-protein kinase Lck
16	9606.ENSP00000376345	0.991	Growth factor receptor-bound protein 2
17	9606.ENSP00000378845	0.990	Linker for activation of T cells
18	9606.ENSP00000304283	0.988	Ras-related C3 botulinum toxin substrate 3
19	9606.ENSP00000428924	0.988	Tyrosine-protein kinase Lyn
20	9606.ENSP00000263125	0.984	Protein kinase C theta type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0001784	0.961	phosphotyrosine residue binding
GO:0005102	0.646	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007165	0.992	signal transduction
GO:0048583	0.988	regulation of response to stimulus
GO:0048522	0.983	positive regulation of cellular process
GO:0050790	0.978	regulation of catalytic activity
GO:0002768	0.962	immune response-regulating cell surface receptor signaling pathway
GO:0042221	0.941	response to chemical
GO:0032501	0.932	multicellular organismal process
GO:0048584	0.920	positive regulation of response to stimulus
GO:0002684	0.910	positive regulation of immune system process
GO:0002376	0.902	immune system process
GO:0032502	0.879	developmental process
GO:0050778	0.877	positive regulation of immune response
GO:0001775	0.873	cell activation
GO:0016043	0.870	cellular component organization
GO:0048856	0.866	anatomical structure development
GO:0050865	0.862	regulation of cell activation
GO:0002429	0.854	immune response-activating cell surface receptor signaling pathway
GO:0010646	0.852	regulation of cell communication
GO:0002694	0.845	regulation of leukocyte activation
GO:0070887	0.829	cellular response to chemical stimulus
GO:0051179	0.818	localization
GO:0051249	0.787	regulation of lymphocyte activation
GO:0023051	0.784	regulation of signaling
GO:0030155	0.780	regulation of cell adhesion
GO:0042060	0.776	wound healing
GO:0035556	0.765	intracellular signal transduction
GO:0007596	0.763	blood coagulation
GO:0030168	0.745	platelet activation
GO:0019222	0.734	regulation of metabolic process
GO:0006909	0.730	phagocytosis
GO:0009966	0.710	regulation of signal transduction
GO:0030154	0.688	cell differentiation
GO:0048468	0.644	cell development
GO:0007169	0.644	transmembrane receptor protein tyrosine kinase signaling pathway
GO:1902531	0.640	regulation of intracellular signal transduction
GO:0051240	0.589	positive regulation of multicellular organismal process
GO:0051336	0.505	regulation of hydrolase activity
GO:0031323	0.486	regulation of cellular metabolic process
GO:0008152	0.445	metabolic process
GO:0009893	0.430	positive regulation of metabolic process
GO:0060255	0.416	regulation of macromolecule metabolic process
GO:0045785	0.400	positive regulation of cell adhesion
GO:0080090	0.394	regulation of primary metabolic process
GO:0051251	0.392	positive regulation of lymphocyte activation
GO:0044237	0.367	cellular metabolic process
GO:0031325	0.367	positive regulation of cellular metabolic process
GO:0048870	0.358	cell motility
GO:0043085	0.343	positive regulation of catalytic activity
GO:0051174	0.338	regulation of phosphorus metabolic process
GO:0043087	0.334	regulation of GTPase activity
GO:0019220	0.331	regulation of phosphate metabolic process
GO:0010604	0.317	positive regulation of macromolecule metabolic process
GO:0051171	0.314	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.999	plasma membrane
GO:0043226	0.609	organelle
GO:0043229	0.565	intracellular organelle
GO:0030054	0.524	cell junction
GO:0043227	0.434	membrane-bounded organelle
GO:0043231	0.396	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]