StarFunc result for job id P15509

User Input

>input (400 residues)
MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKC
FLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTA
AQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHL
DNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQP
RTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAAD
VRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVP
QIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15509	1.000	1.000	7.004E-73	400	1.000	1.000	P15509.pdb.gz	CSF2R_HUMAN Granulocyte-macrophage colony-stimulating factor receptor subunit alpha OS=Homo sapiens OX=9606 GN=CSF2RA PE=1 SV=1
2	AFDB:A0A0G2KAL6	0.677	0.711	4.401E-31	380	0.290	0.305	A0A0G2KAL6.pdb.gz	A0A0G2KAL6_RAT Colony stimulating factor 2 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Csf2ra PE=1 SV=2
3	AFDB:P26951	0.553	0.581	1.491E-26	378	0.270	0.286	P26951.pdb.gz	IL3RA_HUMAN Interleukin-3 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL3RA PE=1 SV=1
4	AFDB:G3V6S7	0.577	0.522	1.620E-24	448	0.247	0.221	G3V6S7.pdb.gz	G3V6S7_RAT Interleukin 5 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il5ra PE=4 SV=2
5	AFDB:Q01344	0.589	0.565	7.869E-24	420	0.223	0.212	Q01344.pdb.gz	IL5RA_HUMAN Interleukin-5 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL5RA PE=1 SV=2
6	AFDB:P21183	0.570	0.552	3.625E-23	415	0.217	0.210	P21183.pdb.gz	IL5RA_MOUSE Interleukin-5 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il5ra PE=1 SV=1
7	AFDB:P26952	0.524	0.529	1.885E-21	396	0.235	0.237	P26952.pdb.gz	IL3RA_MOUSE Interleukin-3 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il3ra PE=1 SV=1
8	AFDB:Q8VHK6	0.544	0.563	8.817E-20	385	0.158	0.164	Q8VHK6.pdb.gz	I13R2_RAT Interleukin-13 receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Il13ra2 PE=2 SV=1
9	AFDB:Q561K3	0.601	0.569	1.275E-19	426	0.193	0.181	Q561K3.pdb.gz	Q561K3_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
10	AFDB:Q14627	0.564	0.591	1.574E-19	380	0.158	0.166	Q14627.pdb.gz	I13R2_HUMAN Interleukin-13 receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=IL13RA2 PE=1 SV=1
11	PDB:7u7nC	0.347	0.598	4.729E-10	200	0.087	0.175	7u7nC.pdb.gz
12	PDB:7z0lB	0.355	0.380	5.062E-9	370	0.117	0.127	7z0lB.pdb.gz
13	PDB:5mj3A	0.282	0.351	6.587E-9	302	0.105	0.139	5mj3A.pdb.gz
14	PDB:6pxvA	0.217	0.125	1.058E-8	823	0.117	0.057	6pxvA.pdb.gz
15	PDB:8eyyA	0.235	0.137	7.432E-8	775	0.107	0.055	8eyyA.pdb.gz
16	PDB:8dtlA	0.230	0.136	7.834E-8	741	0.098	0.053	8dtlA.pdb.gz
17	PDB:3besR	0.325	0.476	5.219E-7	250	0.070	0.112	3besR.pdb.gz
18	PDB:6pyhD	0.216	0.124	4.072E-6	798	0.098	0.049	6pyhD.pdb.gz
19	PDB:7u05B	0.244	0.145	4.594E-5	815	0.070	0.034	7u05B.pdb.gz
20	PDB:4ziqA	0.177	0.066	8.201E-5	1450	0.077	0.021	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15509	0.0	832	400	1.000	1.000	CSF2R_HUMAN Granulocyte-macrophage colony-stimulating factor receptor subunit alpha OS=Homo sapiens OX=9606 GN=CSF2RA PE=1 SV=1
2	Q701L2	3.72e-53	183	384	0.273	0.284	Q701L2_RAT Granulocyte-macrophage colony stimulating receptor alpha OS=Rattus norvegicus OX=10116 GN=Csf2ra PE=2 SV=1
3	M0R536	7.40e-52	179	355	0.242	0.273	M0R536_RAT Colony stimulating factor 2 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Csf2ra PE=1 SV=3
4	A0A0G2KAL6	1.38e-51	179	394	0.273	0.277	A0A0G2KAL6_RAT Colony stimulating factor 2 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Csf2ra PE=1 SV=2
5	A0A8I6B5C9	1.48e-50	175	348	0.235	0.270	A0A8I6B5C9_RAT Colony stimulating factor 2 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Csf2ra PE=1 SV=1
6	P26951	3.19e-47	167	378	0.282	0.299	IL3RA_HUMAN Interleukin-3 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL3RA PE=1 SV=1
7	Q01344	3.84e-22	99.8	420	0.210	0.200	IL5RA_HUMAN Interleukin-5 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL5RA PE=1 SV=2
8	G3V6S7	1.93e-20	94.7	448	0.230	0.205	G3V6S7_RAT Interleukin 5 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il5ra PE=4 SV=2
9	P21183	3.93e-19	90.9	415	0.207	0.200	IL5RA_MOUSE Interleukin-5 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il5ra PE=1 SV=1
10	Q99PS3	6.47e-19	90.1	414	0.198	0.191	Q99PS3_RAT Interleukin-5 receptor alpha chain OS=Rattus norvegicus OX=10116 GN=Il5ra PE=2 SV=1
11	P26952	4.77e-18	87.4	396	0.242	0.245	IL3RA_MOUSE Interleukin-3 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il3ra PE=1 SV=1
12	A0A8I6A448	7.54e-16	80.9	403	0.217	0.216	A0A8I6A448_RAT Interleukin 5 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il5ra PE=4 SV=1
13	P78552	1.32e-10	65.1	427	0.198	0.185	I13R1_HUMAN Interleukin-13 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL13RA1 PE=1 SV=1
14	Q8VHK6	3.35e-10	63.5	385	0.087	0.091	I13R2_RAT Interleukin-13 receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Il13ra2 PE=2 SV=1
15	P16471	4.16e-10	63.9	622	0.168	0.108	PRLR_HUMAN Prolactin receptor OS=Homo sapiens OX=9606 GN=PRLR PE=1 SV=1
16	A0A8I6A7D4	9.50e-10	62.0	390	0.168	0.172	A0A8I6A7D4_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
17	Q561K3	1.04e-09	62.4	426	0.168	0.157	Q561K3_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
18	O88786	2.06e-08	58.2	383	0.083	0.086	I13R2_MOUSE Interleukin-13 receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Il13ra2 PE=1 SV=1
19	E6ZCC8	2.75e-08	57.8	387	0.188	0.194	E6ZCC8_ONCMY IL-13 receptor-alpha-1-a OS=Oncorhynchus mykiss OX=8022 GN=il13Ra1A PE=2 SV=1
20	P34902	1.79e-07	55.1	369	0.165	0.179	IL2RG_MOUSE Cytokine receptor common subunit gamma OS=Mus musculus OX=10090 GN=Il2rg PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18611 IL3Ra_N	4.6e-24	95.5	IL-3 receptor alpha chain N-terminal domain
2	PF09240 IL6Ra-bind	2e-19	81.1	Interleukin-6 receptor alpha chain, binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394227

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296871	0.999	Granulocyte-macrophage colony-stimulating factor
2	9606.ENSP00000384053	0.993	Cytokine receptor common subunit beta
3	9606.ENSP00000371067	0.992	Tyrosine-protein kinase JAK2
4	9606.ENSP00000430684	0.960	Inhibitor of nuclear factor kappa-B kinase subunit beta
5	9606.ENSP00000293328	0.948	Signal transducer and activator of transcription 5B
6	9606.ENSP00000341208	0.948	Signal transducer and activator of transcription 5A
7	9606.ENSP00000401303	0.942	SHC-transforming protein 1
8	9606.ENSP00000340944	0.939	Tyrosine-protein phosphatase non-receptor type 11
9	9606.ENSP00000428056	0.938	Phosphatidylinositol 3-kinase regulatory subunit alpha
10	9606.ENSP00000428924	0.938	Tyrosine-protein kinase Lyn
11	9606.ENSP00000264657	0.922	Signal transducer and activator of transcription 3
12	9606.ENSP00000354394	0.918	Signal transducer and activator of transcription 1-alpha/beta
13	9606.ENSP00000364907	0.916	Tyrosine-protein kinase SYK
14	9606.ENSP00000379350	0.914	Integrin beta-1
15	9606.ENSP00000309591	0.911	cAMP-dependent protein kinase catalytic subunit alpha
16	9606.ENSP00000359719	0.911	cAMP-dependent protein kinase catalytic subunit beta
17	9606.ENSP00000366488	0.911	cAMP-dependent protein kinase catalytic subunit gamma
18	9606.ENSP00000296870	0.910	Interleukin-3
19	9606.ENSP00000376345	0.909	Growth factor receptor-bound protein 2
20	9606.ENSP00000405338	0.906	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0004896	0.321	cytokine receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.998	regulation of biological process
GO:0050896	0.997	response to stimulus
GO:0007165	0.990	signal transduction
GO:0008284	0.985	positive regulation of cell population proliferation
GO:0019221	0.955	cytokine-mediated signaling pathway
GO:0097696	0.908	receptor signaling pathway via STAT
GO:0008152	0.772	metabolic process
GO:0071704	0.680	organic substance metabolic process
GO:0044238	0.666	primary metabolic process
GO:0044237	0.662	cellular metabolic process
GO:0007259	0.637	receptor signaling pathway via JAK-STAT
GO:0006796	0.606	phosphate-containing compound metabolic process
GO:0006807	0.574	nitrogen compound metabolic process
GO:0043170	0.559	macromolecule metabolic process
GO:0019538	0.527	protein metabolic process
GO:0070663	0.522	regulation of leukocyte proliferation
GO:0016310	0.506	phosphorylation
GO:0070665	0.496	positive regulation of leukocyte proliferation
GO:0006468	0.418	protein phosphorylation
GO:0019222	0.373	regulation of metabolic process
GO:0060255	0.330	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.997	protein-containing complex
GO:0098796	0.989	membrane protein complex
GO:0043235	0.985	receptor complex
GO:0098802	0.979	plasma membrane signaling receptor complex
GO:0005622	0.711	intracellular anatomical structure
GO:0043226	0.650	organelle
GO:0043229	0.617	intracellular organelle
GO:0005576	0.599	extracellular region
GO:0043227	0.599	membrane-bounded organelle
GO:0005615	0.510	extracellular space
GO:0030526	0.414	granulocyte macrophage colony-stimulating factor receptor complex
GO:0005737	0.407	cytoplasm
GO:0043231	0.401	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]