StarFunc result for job id P15514

User Input

>input (252 residues)
MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKK
LRQENGNVHAIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15514	1.000	1.000	2.707E-38	252	1.000	1.000	P15514.pdb.gz	AREG_HUMAN Amphiregulin OS=Homo sapiens OX=9606 GN=AREG PE=1 SV=2
2	AFDB:P31955	0.449	0.455	2.269E-27	248	0.702	0.714	P31955.pdb.gz	AREG_MOUSE Amphiregulin OS=Mus musculus OX=10090 GN=Areg PE=2 SV=1
3	AFDB:P24338	0.529	0.545	1.187E-25	243	0.702	0.728	P24338.pdb.gz	AREG_RAT Amphiregulin OS=Rattus norvegicus OX=10116 GN=Areg PE=1 SV=1
4	AFDB:Q9W7C5	0.333	0.382	5.823E-9	212	0.234	0.278	Q9W7C5.pdb.gz	HBEGF_CHICK Proheparin-binding EGF-like growth factor OS=Gallus gallus OX=9031 GN=HBEGF PE=1 SV=1
5	AFDB:Q06175	0.264	0.304	2.329E-7	208	0.222	0.269	Q06175.pdb.gz	HBEGF_RAT Proheparin-binding EGF-like growth factor OS=Rattus norvegicus OX=10116 GN=Hbegf PE=2 SV=1
6	AFDB:Q6DR99	0.275	0.120	1.864E-3	700	0.206	0.074	Q6DR99.pdb.gz	Q6DR99_MOUSE Pro-neuregulin-1, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg1 PE=1 SV=1
7	AFDB:A0A0R4IFE6	0.279	0.122	3.645E-3	687	0.167	0.061	A0A0R4IFE6.pdb.gz	A0A0R4IFE6_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
8	AFDB:Q9ULI3	0.153	0.035	4.662E-2	1381	0.115	0.021	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
9	AFDB:Q9ERQ6	0.202	0.105	7.456E-2	571	0.143	0.063	Q9ERQ6.pdb.gz	CSPG5_RAT Chondroitin sulfate proteoglycan 5 OS=Rattus norvegicus OX=10116 GN=Cspg5 PE=1 SV=1
10	PDB:4rs0A	0.148	0.070	9.896E-2	557	0.056	0.025	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
11	AFDB:X1WE42	0.130	0.030	1.043E-1	1576	0.119	0.019	X1WE42.pdb.gz
12	PDB:5f1aA	0.150	0.072	1.384E-1	553	0.052	0.024	5f1aA.pdb.gz	Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
13	PDB:6y3cA	0.148	0.070	4.628E-1	557	0.056	0.025	6y3cA.pdb.gz
14	PDB:4e0sB	0.124	0.036	1.184	898	0.040	0.011	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
15	PDB:7q3nU	0.094	0.082	1.655	292	0.032	0.027	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
16	PDB:7nycC	0.133	0.043	1.770	809	0.036	0.011	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
17	PDB:5es4B	0.074	0.028	2.475	674	0.024	0.009	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
18	PDB:2pe4A	0.080	0.053	2.647	417	0.032	0.019	2pe4A.pdb.gz
19	PDB:3t5oA	0.114	0.035	3.959	871	0.044	0.013	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
20	PDB:6h03C	0.120	0.061	3.959	513	0.028	0.014	6h03C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15514	0.0	523	252	1.000	1.000	AREG_HUMAN Amphiregulin OS=Homo sapiens OX=9606 GN=AREG PE=1 SV=2
2	P31955	3.75e-98	288	248	0.687	0.698	AREG_MOUSE Amphiregulin OS=Mus musculus OX=10090 GN=Areg PE=2 SV=1
3	P24338	6.44e-80	242	243	0.679	0.704	AREG_RAT Amphiregulin OS=Rattus norvegicus OX=10116 GN=Areg PE=1 SV=1
4	Q9W7C5	8.06e-17	78.6	212	0.175	0.208	HBEGF_CHICK Proheparin-binding EGF-like growth factor OS=Gallus gallus OX=9031 GN=HBEGF PE=1 SV=1
5	A9JRW9	3.75e-13	68.9	230	0.139	0.152	A9JRW9_DANRE Heparin-binding EGF-like growth factor a OS=Danio rerio OX=7955 GN=hbegfa PE=2 SV=1
6	Q99075	3.09e-10	60.5	208	0.131	0.159	HBEGF_HUMAN Proheparin-binding EGF-like growth factor OS=Homo sapiens OX=9606 GN=HBEGF PE=1 SV=1
7	Q06186	2.25e-07	52.4	208	0.103	0.125	HBEGF_MOUSE Proheparin-binding EGF-like growth factor OS=Mus musculus OX=10090 GN=Hbegf PE=2 SV=1
8	Q06175	5.17e-07	51.2	208	0.103	0.125	HBEGF_RAT Proheparin-binding EGF-like growth factor OS=Rattus norvegicus OX=10116 GN=Hbegf PE=2 SV=1
9	A0A8J8YRH0	1.94e-06	49.3	191	0.115	0.152	A0A8J8YRH0_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
10	Q8IYR6	3.09e-06	49.7	380	0.099	0.066	TEFF1_HUMAN Tomoregulin-1 OS=Homo sapiens OX=9606 GN=TMEFF1 PE=1 SV=1
11	A0A8I6AQ55	6.96e-06	47.8	199	0.135	0.171	A0A8I6AQ55_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
12	Q9JJM4	2.66e-05	45.8	177	0.087	0.124	Q9JJM4_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=2 SV=1
13	A0A8I5ZSF9	2.89e-05	45.8	193	0.119	0.155	A0A8I5ZSF9_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
14	O14511	3.77e-05	47.0	850	0.111	0.033	NRG2_HUMAN Pro-neuregulin-2, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG2 PE=1 SV=1
15	Q61521	5.50e-05	44.7	162	0.087	0.136	EREG_MOUSE Proepiregulin OS=Mus musculus OX=10090 GN=Ereg PE=1 SV=1
16	O14944	6.00e-05	44.7	169	0.063	0.095	EREG_HUMAN Proepiregulin OS=Homo sapiens OX=9606 GN=EREG PE=1 SV=1
17	Q9UIK5	1.54e-04	44.7	374	0.119	0.080	TEFF2_HUMAN Tomoregulin-2 OS=Homo sapiens OX=9606 GN=TMEFF2 PE=1 SV=1
18	Q9Z0L5	1.80e-04	43.1	162	0.071	0.111	EREG_RAT Proepiregulin OS=Rattus norvegicus OX=10116 GN=Ereg PE=1 SV=1
19	O35569	2.39e-04	44.3	868	0.067	0.020	NRG2_RAT Pro-neuregulin-2, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg2 PE=1 SV=1
20	Q94918	6.15e-04	43.1	623	0.071	0.029	VEIN_DROME Protein vein OS=Drosophila melanogaster OX=7227 GN=vn PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	9.3	18.0	EGF-like domain
2	PF04999 FtsL	1	20.7	Cell division protein FtsL

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379097

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
2	9606.ENSP00000267101	0.983	Receptor tyrosine-protein kinase erbB-3
3	9606.ENSP00000269571	0.972	Receptor tyrosine-protein kinase erbB-2
4	9606.ENSP00000256078	0.958	GTPase KRas
5	9606.ENSP00000265171	0.958	Pro-epidermal growth factor
6	9606.ENSP00000407586	0.957	GTPase HRas
7	9606.ENSP00000244869	0.942	Proepiregulin
8	9606.ENSP00000306245	0.935	Proto-oncogene c-Fos
9	9606.ENSP00000379092	0.925	Probetacellulin
10	9606.ENSP00000358548	0.918	GTPase NRas
11	9606.ENSP00000273261	0.917	Leucine-rich repeats and immunoglobulin-like domains protein 1
12	9606.ENSP00000267257	0.909	Paxillin
13	9606.ENSP00000220003	0.905	Tyrosine-protein kinase CSK
14	9606.ENSP00000363667	0.905	Tyrosine-protein phosphatase non-receptor type 3
15	9606.ENSP00000222547	0.901	BET1 homolog
16	9606.ENSP00000220597	0.900	Phosphoprotein associated with glycosphingolipid-enriched microdomains 1
17	9606.ENSP00000259400	0.900	Syntaxin-17
18	9606.ENSP00000357196	0.900	Receptor-type tyrosine-protein phosphatase kappa
19	9606.ENSP00000390783	0.900	Sec1 family domain-containing protein 1
20	9606.ENSP00000411898	0.896	Epigen

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	1.000	growth factor activity
GO:0030297	1.000	transmembrane receptor protein tyrosine kinase activator activity
GO:0070851	0.390	growth factor receptor binding
GO:0005154	0.345	epidermal growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050896	0.997	response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0007154	0.990	cell communication
GO:0023052	0.986	signaling
GO:0007165	0.982	signal transduction
GO:0038127	0.954	ERBB signaling pathway
GO:0048518	0.946	positive regulation of biological process
GO:0007173	0.941	epidermal growth factor receptor signaling pathway
GO:0048522	0.937	positive regulation of cellular process
GO:0008284	0.925	positive regulation of cell population proliferation
GO:0050678	0.908	regulation of epithelial cell proliferation
GO:0032501	0.556	multicellular organismal process
GO:0019222	0.517	regulation of metabolic process
GO:0060255	0.490	regulation of macromolecule metabolic process
GO:0032502	0.476	developmental process
GO:0048856	0.462	anatomical structure development
GO:0080090	0.451	regulation of primary metabolic process
GO:0051171	0.449	regulation of nitrogen compound metabolic process
GO:0031323	0.413	regulation of cellular metabolic process
GO:0010837	0.409	regulation of keratinocyte proliferation
GO:0042221	0.358	response to chemical
GO:0048519	0.349	negative regulation of biological process
GO:0009893	0.339	positive regulation of metabolic process
GO:0031325	0.326	positive regulation of cellular metabolic process
GO:0010604	0.323	positive regulation of macromolecule metabolic process
GO:0051246	0.321	regulation of protein metabolic process
GO:0051173	0.313	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0016020	0.980	membrane
GO:0031090	0.939	organelle membrane
GO:0031982	0.934	vesicle
GO:0098588	0.926	bounding membrane of organelle
GO:0005783	0.924	endoplasmic reticulum
GO:0071944	0.923	cell periphery
GO:0031410	0.917	cytoplasmic vesicle
GO:0030659	0.907	cytoplasmic vesicle membrane
GO:0005886	0.694	plasma membrane
GO:0031984	0.690	organelle subcompartment
GO:0042175	0.687	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.681	endoplasmic reticulum membrane
GO:0005634	0.669	nucleus
GO:0030139	0.658	endocytic vesicle
GO:0030134	0.654	COPII-coated ER to Golgi transport vesicle
GO:0030666	0.635	endocytic vesicle membrane
GO:0009986	0.624	cell surface
GO:0030133	0.621	transport vesicle
GO:0030658	0.612	transport vesicle membrane
GO:0030662	0.606	coated vesicle membrane
GO:0033116	0.601	endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0012507	0.596	ER to Golgi transport vesicle membrane
GO:0030669	0.506	clathrin-coated endocytic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]