StarFunc result for job id P15538

User Input

>input (503 residues)
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQG
YEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELS
PDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQED
IKMVYSFILRPSMFPLLTFRAIN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15538	1.000	1.000	7.660E-82	503	1.000	1.000	P15538.pdb.gz	C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11B1 PE=1 SV=5
2	PDB:7m8iA	0.906	0.798	7.660E-63	572	0.875	0.769	7m8iA.pdb.gz	Structural and functional insights into aldosterone synthase interaction with its redox partner protein adrenodoxin.
3	AFDB:P30099	0.939	0.926	3.795E-61	510	0.680	0.671	P30099.pdb.gz	C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11b2 PE=1 SV=1
4	AFDB:P15393	0.934	0.942	3.630E-60	499	0.634	0.639	P15393.pdb.gz	C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11b1 PE=1 SV=1
5	AFDB:Q3TG86	0.918	0.922	5.020E-59	501	0.638	0.641	Q3TG86.pdb.gz	Q3TG86_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=1 SV=1
6	AFDB:A9JRV2	0.891	0.718	4.081E-45	628	0.416	0.333	A9JRV2.pdb.gz
7	AFDB:P00189	0.914	0.886	3.252E-43	520	0.354	0.342	P00189.pdb.gz	CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus OX=9913 GN=CYP11A1 PE=1 SV=1
8	AFDB:A0A2R8Q770	0.891	0.856	1.296E-42	524	0.374	0.359	A0A2R8Q770.pdb.gz
9	AFDB:Q9QZ82	0.900	0.862	1.296E-42	526	0.354	0.338	Q9QZ82.pdb.gz	CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus OX=10090 GN=Cyp11a1 PE=1 SV=1
10	AFDB:P14137	0.907	0.869	2.470E-42	526	0.346	0.331	P14137.pdb.gz	CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11a1 PE=1 SV=1
11	AFDB:P05108	0.894	0.864	7.130E-42	521	0.378	0.365	P05108.pdb.gz	CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11A1 PE=1 SV=2
12	PDB:3na1A	0.890	0.947	4.175E-40	472	0.364	0.388	3na1A.pdb.gz	Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.
13	PDB:3mzsA	0.883	0.943	3.813E-39	470	0.344	0.368	3mzsA.pdb.gz	Structural Basis for Three-step Sequential Catalysis by the Cholesterol Side Chain Cleavage Enzyme CYP11A1.
14	PDB:3k9vA	0.822	0.887	1.476E-28	464	0.272	0.295	3k9vA.pdb.gz	Crystal structure of CYP24A1, a mitochondrial cytochrome P450 involved in vitamin D metabolism.
15	PDB:7cb9A	0.729	0.781	2.068E-19	466	0.193	0.208	7cb9A.pdb.gz	CYP76AH1 from Salvia miltiorrhiza
16	PDB:5veuC	0.724	0.772	3.595E-19	469	0.189	0.203	5veuC.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
17	PDB:7n3mAAA	0.726	0.827	5.198E-19	437	0.181	0.208	7n3mAAA.pdb.gz	Discovery of Novel 3-Piperidinyl Pyridine Derivatives as Highly Potent and Selective Cholesterol 24-Hydroxylase (CH24H) Inhibitors.
18	PDB:4nz2A	0.718	0.772	9.037E-19	464	0.199	0.216	4nz2A.pdb.gz	Structure-based ligand design to overcome CYP inhibition in drug discovery projects.
19	PDB:5te8B	0.741	0.788	2.169E-18	471	0.173	0.185	5te8B.pdb.gz	Structural basis for regiospecific midazolam oxidation by human cytochrome P450 3A4.
20	PDB:3eqmA	0.751	0.828	2.608E-18	452	0.173	0.192	3eqmA.pdb.gz	Structural basis for androgen specificity and oestrogen synthesis in human aromatase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15393	0.0	651	499	0.636	0.641	C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11b1 PE=1 SV=1
2	P15538	0.0	1035	503	1.000	1.000	C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11B1 PE=1 SV=5
3	P15539	0.0	689	500	0.678	0.682	C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus OX=10090 GN=Cyp11b2 PE=2 SV=3
4	P19099	0.0	925	503	0.932	0.932	C11B2_HUMAN Cytochrome P450 11B2, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11B2 PE=1 SV=3
5	P30099	0.0	686	510	0.680	0.671	C11B2_RAT Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11b2 PE=1 SV=1
6	P30100	0.0	690	500	0.684	0.688	C11B3_RAT Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11b3 PE=1 SV=1
7	Q3TG86	0.0	664	501	0.638	0.641	Q3TG86_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=1 SV=1
8	Q3TR45	0.0	660	498	0.636	0.643	Q3TR45_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=2 SV=1
9	Q3UQH5	0.0	662	501	0.636	0.639	Q3UQH5_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=2 SV=1
10	A1XRK1	8.96e-130	389	518	0.406	0.394	A1XRK1_DANRE Cytochrome P450, family 11, subfamily C, polypeptide 1 OS=Danio rerio OX=7955 GN=cyp11b2 PE=1 SV=1
11	Q7SYJ6	1.30e-114	349	509	0.366	0.361	Q7SYJ6_DANRE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Danio rerio OX=7955 GN=cyp11a1.1 PE=1 SV=1
12	P00189	6.70e-113	345	520	0.350	0.338	CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus OX=9913 GN=CYP11A1 PE=1 SV=1
13	P05108	8.43e-111	340	521	0.370	0.357	CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11A1 PE=1 SV=2
14	Q9QZ82	6.94e-109	335	526	0.348	0.333	CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus OX=10090 GN=Cyp11a1 PE=1 SV=1
15	P14137	4.10e-107	331	526	0.344	0.329	CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11a1 PE=1 SV=1
16	O73684	2.14e-65	221	508	0.270	0.268	O73684_CHICK 25-hydroxyvitamin D3 24-hydroxylase OS=Gallus gallus OX=9031 GN=cP450cc24 PE=2 SV=1
17	A0A097HUX0	3.83e-64	218	505	0.294	0.293	A0A097HUX0_DANRE 25-hydroxyvitamin D-1alpha-hydroxylase OS=Danio rerio OX=7955 GN=cyp27b1 PE=2 SV=1
18	Q64441	2.43e-63	216	514	0.260	0.255	CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp24a1 PE=2 SV=1
19	Q09128	1.84e-62	214	514	0.262	0.257	CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp24a1 PE=1 SV=1
20	Q07973	2.25e-61	211	514	0.256	0.251	CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP24A1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	5.4e-101	350.3	Cytochrome P450
2	PF05438 TRH	8e+02	11.2	Thyrotropin-releasing hormone (TRH)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000292427

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000445122	0.985	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
2	9606.ENSP00000358421	0.981	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
3	9606.ENSP00000316786	0.974	Corticosteroid 11-beta-dehydrogenase isozyme 2
4	9606.ENSP00000364412	0.966	Testosterone 17-beta-dehydrogenase 3
5	9606.ENSP00000355995	0.962	Corticosteroid 11-beta-dehydrogenase isozyme 1
6	9606.ENSP00000358903	0.954	Steroid 17-alpha-hydroxylase/17,20 lyase
7	9606.ENSP00000408860	0.952	Steroid 21-hydroxylase
8	9606.ENSP00000477587	0.948	3-oxo-5-alpha-steroid 4-dehydrogenase 2
9	9606.ENSP00000369927	0.947	Aldo-keto reductase family 1 member C3
10	9606.ENSP00000379683	0.947	Aromatase
11	9606.ENSP00000274192	0.939	3-oxo-5-alpha-steroid 4-dehydrogenase 1
12	9606.ENSP00000242375	0.932	3-oxo-5-beta-steroid 4-dehydrogenase
13	9606.ENSP00000325822	0.931	Cytochrome P450 11B2, mitochondrial
14	9606.ENSP00000199936	0.923	Estradiol 17-beta-dehydrogenase 2
15	9606.ENSP00000264228	0.923	Polyprenol reductase
16	9606.ENSP00000451406	0.920	17-beta-hydroxysteroid dehydrogenase type 6
17	9606.ENSP00000370254	0.918	Aldo-keto reductase family 1 member C1
18	9606.ENSP00000480443	0.908	Hydroxysteroid 11-beta-dehydrogenase 1-like protein
19	9606.ENSP00000363794	0.903	Estradiol 17-beta-dehydrogenase 8
20	9606.ENSP00000260270	0.873	Adrenodoxin, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008395	1.000	steroid hydroxylase activity
GO:0020037	1.000	heme binding
GO:0016713	1.000	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen
GO:0005515	0.468	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0120254	0.996	olefinic compound metabolic process
GO:0120178	0.996	steroid hormone biosynthetic process
GO:0042445	0.995	hormone metabolic process
GO:0006066	0.995	alcohol metabolic process
GO:0042180	0.995	cellular ketone metabolic process
GO:0044283	0.993	small molecule biosynthetic process
GO:0008207	0.988	C21-steroid hormone metabolic process
GO:0042181	0.981	ketone biosynthetic process
GO:0034309	0.980	primary alcohol biosynthetic process
GO:1902644	0.976	tertiary alcohol metabolic process
GO:0042446	0.974	hormone biosynthetic process
GO:0120255	0.972	olefinic compound biosynthetic process
GO:0050896	0.962	response to stimulus
GO:1902645	0.707	tertiary alcohol biosynthetic process
GO:0048878	0.620	chemical homeostasis
GO:0032501	0.536	multicellular organismal process
GO:0042221	0.439	response to chemical
GO:0051716	0.436	cellular response to stimulus
GO:0070887	0.307	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031090	0.997	organelle membrane
GO:0005739	0.991	mitochondrion
GO:0031975	0.982	envelope
GO:0031967	0.870	organelle envelope
GO:0005743	0.811	mitochondrial inner membrane
GO:0012505	0.368	endomembrane system
GO:0070013	0.340	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:43836	1.000	cholesterol + H(+) + NADPH + O2 = 26-hydroxycholesterol + H2O + NADP(+)
EC:1.14.15.-	1.000	With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen.

[back to server]