StarFunc result for job id P15692

User Input

>input (232 residues)
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15692	1.000	1.000	1.387E-41	232	1.000	1.000	P15692.pdb.gz	VEGFA_HUMAN Vascular endothelial growth factor A, long form OS=Homo sapiens OX=9606 GN=VEGFA PE=1 SV=3
2	AFDB:P15691	0.511	0.610	1.767E-30	190	0.776	0.947	P15691.pdb.gz	VEGFA_BOVIN Vascular endothelial growth factor A OS=Bos taurus OX=9913 GN=VEGFA PE=1 SV=1
3	AFDB:P67964	0.537	0.570	5.506E-30	216	0.698	0.750	P67964.pdb.gz	VEGFA_CHICK Vascular endothelial growth factor A OS=Gallus gallus OX=9031 GN=VEGFA PE=2 SV=1
4	AFDB:Q1ECU5	0.468	0.436	1.211E-23	250	0.504	0.468	Q1ECU5.pdb.gz
5	AFDB:O73682	0.447	0.546	5.451E-22	188	0.483	0.596	O73682.pdb.gz	VGFAA_DANRE Vascular endothelial growth factor A-A OS=Danio rerio OX=7955 GN=vegfaa PE=1 SV=1
6	AFDB:Q5RHW5	0.466	0.474	8.589E-22	228	0.448	0.456	Q5RHW5.pdb.gz
7	AFDB:E7EZR4	0.402	0.379	1.694E-19	246	0.328	0.309	E7EZR4.pdb.gz	E7EZR4_DANRE Vascular endothelial growth factor A-like OS=Danio rerio OX=7955 GN=vegfba PE=3 SV=1
8	AFDB:P49763	0.476	0.497	8.503E-14	221	0.284	0.299	P49763.pdb.gz	PLGF_HUMAN Placenta growth factor OS=Homo sapiens OX=9606 GN=PGF PE=1 SV=2
9	AFDB:P67863	0.430	0.676	2.649E-13	145	0.250	0.400	P67863.pdb.gz	TXVE_VIPAA Snake venom vascular endothelial growth factor toxin vammin OS=Vipera ammodytes ammodytes OX=8705 PE=1 SV=2
10	AFDB:Q330K6	0.425	0.675	3.726E-13	143	0.241	0.392	Q330K6.pdb.gz	TXVE2_PROMU Snake venom vascular endothelial growth factor toxin OS=Protobothrops mucrosquamatus OX=103944 PE=1 SV=1
11	PDB:1wq8A	0.403	0.910	1.050E-10	100	0.207	0.480	1wq8A.pdb.gz
12	PDB:1m4uA	0.216	0.243	4.188E-3	199	0.091	0.106	1m4uA.pdb.gz
13	PDB:2k8pA	0.276	0.323	5.564E-3	189	0.108	0.132	2k8pA.pdb.gz
14	PDB:5nxsA	0.227	0.189	1.305E-2	290	0.082	0.066	5nxsA.pdb.gz
15	PDB:5ntuA	0.226	0.178	1.547E-2	308	0.082	0.062	5ntuA.pdb.gz
16	PDB:5ffoG	0.221	0.180	2.303E-2	297	0.060	0.047	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
17	PDB:7ag0A	0.224	0.331	2.438E-2	140	0.060	0.100	7ag0A.pdb.gz
18	PDB:5vqfB	0.212	0.164	2.731E-2	320	0.065	0.047	5vqfB.pdb.gz
19	PDB:7uwmA	0.201	0.334	3.060E-2	109	0.091	0.193	7uwmA.pdb.gz
20	PDB:6hgoC	0.199	0.300	3.841E-2	127	0.095	0.173	6hgoC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15692	5.84e-176	484	232	1.000	1.000	VEGFA_HUMAN Vascular endothelial growth factor A, long form OS=Homo sapiens OX=9606 GN=VEGFA PE=1 SV=3
2	Q9MYV3	5.35e-126	357	214	0.884	0.958	VEGFA_CANLF Vascular endothelial growth factor A OS=Canis lupus familiaris OX=9615 GN=VEGFA PE=1 SV=1
3	Q00731	2.88e-120	342	214	0.836	0.907	VEGFA_MOUSE Vascular endothelial growth factor A, long form OS=Mus musculus OX=10090 GN=Vegfa PE=1 SV=3
4	P16612	3.07e-120	342	214	0.836	0.907	VEGFA_RAT Vascular endothelial growth factor A OS=Rattus norvegicus OX=10116 GN=Vegfa PE=1 SV=2
5	P15691	3.69e-116	331	190	0.776	0.947	VEGFA_BOVIN Vascular endothelial growth factor A OS=Bos taurus OX=9913 GN=VEGFA PE=1 SV=1
6	P67964	1.62e-98	287	216	0.612	0.657	VEGFA_CHICK Vascular endothelial growth factor A OS=Gallus gallus OX=9031 GN=VEGFA PE=2 SV=1
7	P67965	1.62e-98	287	216	0.612	0.657	VEGFA_COTJA Vascular endothelial growth factor A OS=Coturnix japonica OX=93934 GN=VEGFA PE=2 SV=1
8	O73682	1.12e-69	213	188	0.478	0.590	VGFAA_DANRE Vascular endothelial growth factor A-A OS=Danio rerio OX=7955 GN=vegfaa PE=1 SV=1
9	Q0QYI0	2.08e-61	192	194	0.453	0.541	Q0QYI0_DANRE Vascular endothelial growth factor A isoform 2 precursor (Fragment) OS=Danio rerio OX=7955 GN=fd42e02 PE=2 SV=1
10	P49764	1.82e-34	122	158	0.267	0.392	PLGF_MOUSE Placenta growth factor OS=Mus musculus OX=10090 GN=Pgf PE=2 SV=1
11	Q63434	2.44e-34	122	158	0.272	0.399	PLGF_RAT Placenta growth factor OS=Rattus norvegicus OX=10116 GN=Pgf PE=1 SV=1
12	P49763	2.12e-32	119	221	0.220	0.231	PLGF_HUMAN Placenta growth factor OS=Homo sapiens OX=9606 GN=PGF PE=1 SV=2
13	E7EZR4	1.15e-31	118	246	0.319	0.301	E7EZR4_DANRE Vascular endothelial growth factor A-like OS=Danio rerio OX=7955 GN=vegfba PE=3 SV=1
14	Q330K6	4.57e-31	113	143	0.237	0.385	TXVE2_PROMU Snake venom vascular endothelial growth factor toxin OS=Protobothrops mucrosquamatus OX=103944 PE=1 SV=1
15	P83942	1.71e-29	108	110	0.207	0.436	TXVE_VIPAP Snake venom vascular endothelial growth factor toxin HF OS=Vipera aspis aspis OX=194601 PE=1 SV=1
16	P67863	3.00e-29	108	145	0.233	0.372	TXVE_VIPAA Snake venom vascular endothelial growth factor toxin vammin OS=Vipera ammodytes ammodytes OX=8705 PE=1 SV=2
17	P49766	2.79e-25	100	207	0.211	0.237	VEGFB_MOUSE Vascular endothelial growth factor B OS=Mus musculus OX=10090 GN=Vegfb PE=2 SV=2
18	O35485	9.92e-25	99.0	207	0.250	0.280	VEGFB_RAT Vascular endothelial growth factor B OS=Rattus norvegicus OX=10116 GN=Vegfb PE=2 SV=3
19	P49765	1.08e-24	99.0	207	0.241	0.271	VEGFB_HUMAN Vascular endothelial growth factor B OS=Homo sapiens OX=9606 GN=VEGFB PE=1 SV=2
20	Q7LAP4	1.08e-24	99.0	207	0.241	0.271	Q7LAP4_HUMAN Vascular endothelial growth factor B OS=Homo sapiens OX=9606 GN=VEGFB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00341 PDGF	2.7e-24	96.6	PDGF/VEGF domain
2	PF14554 VEGF_C	1e-24	97.7	VEGF heparin-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012398

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000012526	0.997	Kinase insert domain receptor (a type III receptor tyrosine kinase)
2	9593.ENSGGOP00000008560	0.996	Fms-related tyrosine kinase 1
3	9593.ENSGGOP00000009321	0.992	Neuropilin 2
4	9593.ENSGGOP00000001478	0.991	Neuropilin 1
5	9593.ENSGGOP00000020321	0.982	Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
6	9593.ENSGGOP00000028093	0.981	Hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
7	9593.ENSGGOP00000014380	0.924	Placental growth factor
8	9593.ENSGGOP00000005913	0.888	Heat shock protein 90 alpha family class A member 1
9	9593.ENSGGOP00000005598	0.884	Cadherin 5
10	9593.ENSGGOP00000020538	0.884	Signal transducer and activator of transcription 3 (acute-phase response factor)
11	9593.ENSGGOP00000016427	0.877	Nitric oxide synthase
12	9593.ENSGGOP00000018546	0.871	Interleukin 6
13	9593.ENSGGOP00000007283	0.868	Tyrosine-protein kinase
14	9593.ENSGGOP00000005989	0.860	Integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
15	9593.ENSGGOP00000013944	0.859	Interleukin 10
16	9593.ENSGGOP00000015019	0.859	Aryl hydrocarbon receptor nuclear translocator
17	9593.ENSGGOP00000013243	0.853	Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
18	9593.ENSGGOP00000010821	0.850	Vitronectin
19	9593.ENSGGOP00000015545	0.849	TEK tyrosine kinase, endothelial
20	9593.ENSGGOP00000003172	0.844	Jun proto-oncogene, AP-1 transcription factor subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	1.000	growth factor activity
GO:0005172	0.999	vascular endothelial growth factor receptor binding
GO:0042056	0.990	chemoattractant activity
GO:0042802	0.987	identical protein binding
GO:0097367	0.829	carbohydrate derivative binding
GO:0005125	0.823	cytokine activity
GO:0050840	0.821	extracellular matrix binding
GO:0005539	0.797	glycosaminoglycan binding
GO:1901681	0.767	sulfur compound binding
GO:0008201	0.746	heparin binding
GO:0001968	0.745	fibronectin binding
GO:0038191	0.732	neuropilin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.981	regulation of biological process
GO:0050896	0.975	response to stimulus
GO:0048518	0.974	positive regulation of biological process
GO:0001568	0.968	blood vessel development
GO:0009987	0.967	cellular process
GO:0050794	0.955	regulation of cellular process
GO:0035295	0.949	tube development
GO:0008284	0.936	positive regulation of cell population proliferation
GO:0045765	0.936	regulation of angiogenesis
GO:0007169	0.924	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0001525	0.917	angiogenesis
GO:0042221	0.890	response to chemical
GO:0051094	0.871	positive regulation of developmental process
GO:1904018	0.845	positive regulation of vasculature development
GO:0048010	0.841	vascular endothelial growth factor receptor signaling pathway
GO:0065008	0.831	regulation of biological quality
GO:0019222	0.798	regulation of metabolic process
GO:0040012	0.785	regulation of locomotion
GO:0042325	0.771	regulation of phosphorylation
GO:0051247	0.753	positive regulation of protein metabolic process
GO:0045766	0.750	positive regulation of angiogenesis
GO:0030334	0.736	regulation of cell migration
GO:0031399	0.732	regulation of protein modification process
GO:0010941	0.727	regulation of cell death
GO:0048519	0.700	negative regulation of biological process
GO:0001932	0.700	regulation of protein phosphorylation
GO:0010557	0.689	positive regulation of macromolecule biosynthetic process
GO:0048523	0.679	negative regulation of cellular process
GO:0010033	0.675	response to organic substance
GO:0010468	0.669	regulation of gene expression
GO:0002040	0.666	sprouting angiogenesis
GO:0044093	0.660	positive regulation of molecular function
GO:0009967	0.659	positive regulation of signal transduction
GO:0030154	0.647	cell differentiation
GO:0031325	0.640	positive regulation of cellular metabolic process
GO:1902531	0.622	regulation of intracellular signal transduction
GO:0050790	0.611	regulation of catalytic activity
GO:0008015	0.611	blood circulation
GO:0043067	0.611	regulation of programmed cell death
GO:0040017	0.611	positive regulation of locomotion
GO:0031326	0.610	regulation of cellular biosynthetic process
GO:0045935	0.609	positive regulation of nucleobase-containing compound metabolic process
GO:0050678	0.606	regulation of epithelial cell proliferation
GO:0006950	0.604	response to stress
GO:0003018	0.603	vascular process in circulatory system
GO:0009605	0.600	response to external stimulus
GO:0007507	0.596	heart development
GO:0031328	0.593	positive regulation of cellular biosynthetic process
GO:0001936	0.587	regulation of endothelial cell proliferation
GO:0070887	0.581	cellular response to chemical stimulus
GO:0001938	0.568	positive regulation of endothelial cell proliferation
GO:1902533	0.568	positive regulation of intracellular signal transduction
GO:0043114	0.560	regulation of vascular permeability
GO:0045597	0.558	positive regulation of cell differentiation
GO:0051896	0.555	regulation of protein kinase B signaling
GO:0071310	0.546	cellular response to organic substance
GO:0016477	0.539	cell migration
GO:2000147	0.535	positive regulation of cell motility
GO:0051897	0.535	positive regulation of protein kinase B signaling
GO:0030335	0.529	positive regulation of cell migration
GO:0010628	0.509	positive regulation of gene expression
GO:0002682	0.504	regulation of immune system process
GO:0043408	0.480	regulation of MAPK cascade
GO:0043085	0.477	positive regulation of catalytic activity
GO:0051336	0.464	regulation of hydrolase activity
GO:0006935	0.464	chemotaxis
GO:0071363	0.457	cellular response to growth factor stimulus
GO:0008152	0.432	metabolic process
GO:0033554	0.432	cellular response to stress
GO:0036293	0.416	response to decreased oxygen levels
GO:0009888	0.388	tissue development
GO:0051128	0.387	regulation of cellular component organization
GO:0048468	0.371	cell development
GO:0009892	0.309	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0043227	0.985	membrane-bounded organelle
GO:0005737	0.947	cytoplasm
GO:0043231	0.937	intracellular membrane-bounded organelle
GO:0012505	0.829	endomembrane system
GO:0009986	0.818	cell surface
GO:0043233	0.789	organelle lumen
GO:0070013	0.784	intracellular organelle lumen
GO:0031982	0.760	vesicle
GO:0005634	0.456	nucleus
GO:0031410	0.420	cytoplasmic vesicle
GO:0099503	0.410	secretory vesicle
GO:0030141	0.393	secretory granule
GO:0071944	0.365	cell periphery
GO:0032991	0.335	protein-containing complex
GO:0016020	0.319	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]