StarFunc result for job id P15735

User Input

>input (406 residues)
MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAE
RLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLT
EKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEP
GEKLRELCGTPGYLAPEILKCSMDETHPGYGKEVDLWACGVILFTLLAGSPPFWHRRQIL
MLRMIMEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARLTAEQALQHPFFERCEGSQPW
NLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLYGH
WVKKGEQQNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3KNN3	0.704	0.697	8.794E-68	410	1.000	0.990	J3KNN3.pdb.gz	J3KNN3_HUMAN phosphorylase kinase OS=Homo sapiens OX=9606 GN=PHKG2 PE=1 SV=1
2	AFDB:P07934	0.697	0.729	1.616E-52	388	0.581	0.608	P07934.pdb.gz	PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus OX=10090 GN=Phkg1 PE=1 SV=3
3	AFDB:A0JME5	0.695	0.716	1.908E-52	394	0.576	0.594	A0JME5.pdb.gz	A0JME5_DANRE phosphorylase kinase OS=Danio rerio OX=7955 GN=zgc:153009 PE=2 SV=1
4	AFDB:X2JEJ4	0.697	0.723	4.858E-48	391	0.512	0.532	X2JEJ4.pdb.gz	X2JEJ4_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=3 SV=1
5	AFDB:Q961E7	0.670	0.650	6.748E-46	419	0.517	0.501	Q961E7.pdb.gz	Q961E7_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=2 SV=1
6	AFDB:Q9I7D0	0.674	0.490	4.065E-42	560	0.522	0.379	Q9I7D0.pdb.gz	Q9I7D0_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=2 SV=3
7	AFDB:G5EDZ5	0.614	0.374	2.158E-30	681	0.342	0.204	G5EDZ5.pdb.gz	G5EDZ5_CAEEL calcium/calmodulin-dependent protein kinase OS=Caenorhabditis elegans OX=6239 GN=unc-43 PE=1 SV=1
8	AFDB:Q4V9P8	0.615	0.452	5.240E-30	560	0.320	0.232	Q4V9P8.pdb.gz	Q4V9P8_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2ga PE=1 SV=1
9	AFDB:Q8BWQ5	0.611	0.320	5.538E-30	790	0.273	0.141	Q8BWQ5.pdb.gz	DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus OX=10090 GN=Dclk3 PE=1 SV=2
10	AFDB:B9DFC1	0.611	0.488	6.540E-30	512	0.298	0.236	B9DFC1.pdb.gz	B9DFC1_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=At3g01090 PE=1 SV=1
11	PDB:5u6yA	0.597	0.530	2.533E-28	459	0.271	0.240	5u6yA.pdb.gz
12	PDB:7myjC	0.583	0.512	1.662E-25	465	0.283	0.247	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
13	PDB:4zhxA	0.580	0.576	2.074E-25	409	0.251	0.249	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
14	PDB:6b1uA	0.587	0.541	3.416E-25	442	0.276	0.253	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
15	PDB:3soaA	0.611	0.570	3.611E-25	436	0.298	0.278	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
16	PDB:2yaaA	0.613	0.818	5.626E-25	300	0.254	0.343	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
17	PDB:4rerA	0.590	0.524	3.705E-24	459	0.264	0.233	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:4rewA	0.586	0.579	7.617E-24	411	0.249	0.246	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:5ufuA	0.587	0.643	7.617E-24	369	0.239	0.263	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:8bfsA	0.532	0.766	1.254E-23	274	0.249	0.369	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JME5	0.0	527	394	0.576	0.594	A0JME5_DANRE phosphorylase kinase OS=Danio rerio OX=7955 GN=zgc:153009 PE=2 SV=1
2	J3KNN3	0.0	835	410	1.000	0.990	J3KNN3_HUMAN phosphorylase kinase OS=Homo sapiens OX=9606 GN=PHKG2 PE=1 SV=1
3	P00518	0.0	517	387	0.584	0.612	PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus OX=9986 GN=PHKG1 PE=1 SV=2
4	P07934	0.0	523	388	0.586	0.613	PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus OX=10090 GN=Phkg1 PE=1 SV=3
5	P13286	0.0	525	388	0.591	0.619	PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus OX=10116 GN=Phkg1 PE=2 SV=2
6	P15735	0.0	841	406	1.000	1.000	PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens OX=9606 GN=PHKG2 PE=1 SV=1
7	P31325	0.0	788	406	0.926	0.926	PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus OX=10116 GN=Phkg2 PE=1 SV=1
8	Q16816	0.0	529	387	0.591	0.620	PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens OX=9606 GN=PHKG1 PE=2 SV=3
9	Q9DB30	0.0	790	406	0.936	0.936	PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus OX=10090 GN=Phkg2 PE=2 SV=2
10	X2JEJ4	2.51e-151	435	391	0.517	0.537	X2JEJ4_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=3 SV=1
11	Q961E7	2.89e-147	426	419	0.517	0.501	Q961E7_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=2 SV=1
12	Q9I7D0	1.09e-124	373	560	0.429	0.311	Q9I7D0_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=2 SV=3
13	Q9VYV7	1.44e-121	365	560	0.419	0.304	Q9VYV7_DROME phosphorylase kinase OS=Drosophila melanogaster OX=7227 GN=PhKgamma PE=4 SV=2
14	G5EDZ5	1.44e-68	231	681	0.298	0.178	G5EDZ5_CAEEL calcium/calmodulin-dependent protein kinase OS=Caenorhabditis elegans OX=6239 GN=unc-43 PE=1 SV=1
15	O62305	5.14e-68	230	720	0.291	0.164	KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans OX=6239 GN=unc-43 PE=1 SV=2
16	Q00168	4.06e-66	221	530	0.286	0.219	KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster OX=7227 GN=CaMKII PE=1 SV=1
17	Q4V9P8	6.91e-66	221	560	0.337	0.245	Q4V9P8_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2ga PE=1 SV=1
18	F1QW17	6.78e-65	219	587	0.291	0.201	F1QW17_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2g2 PE=1 SV=3
19	Q14012	2.49e-64	212	370	0.281	0.308	KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1
20	Q91YS8	8.00e-64	211	374	0.281	0.305	KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus OX=10090 GN=Camk1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4.1	18.0	ABC1 atypical kinase-like domain
2	PF01636 APH	0.49	21.8	Phosphotransferase enzyme family
3	PF01633 Choline_kinase	3.6e+02	12.2	Choline/ethanolamine kinase
4	PF10985 DUF2805	3.8e+02	12.8	Protein of unknown function (DUF2805)
5	PF14842 FliG_N	4.5e+02	12.8	FliG N-terminal domain
6	PF13095 FTA2	6.5e+02	11.4	Kinetochore Sim4 complex subunit FTA2
7	PF12330 Haspin_kinase	2.3e+02	12.1	Haspin like kinase domain
8	PF06293 Kdo	0.67	20.8	Lipopolysaccharide kinase (Kdo/WaaP) family
9	PF14531 Kinase-like	0.075	23.9	Kinase-like
10	PF00069 Pkinase	2.9e-75	264.7	Protein kinase domain
11	PF17667 Pkinase_fungal	16	15.7	Fungal protein kinase
12	PF07714 PK_Tyr_Ser-Thr	2e-28	110.9	Protein tyrosine and serine/threonine kinase
13	PF05445 Pox_ser-thr_kin	5.7e+02	10.8	Poxvirus serine/threonine protein kinase
14	PF01163 RIO1	25	15.9	RIO1 family
15	PF19974 TCAD9	2.3e+02	12.2	Ternary complex associated domain 9
16	PF10707 YrbL-PhoP_reg	2.5e+02	12.7	PhoP regulatory network protein YrbL

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000455607

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369274	0.998	Phosphorylase b kinase regulatory subunit alpha, liver isoform
2	9606.ENSP00000362643	0.996	Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
3	9606.ENSP00000313504	0.995	Phosphorylase b kinase regulatory subunit beta
4	9606.ENSP00000216392	0.963	Glycogen phosphorylase, liver form
5	9606.ENSP00000272298	0.884	Calmodulin 2 (phosphorylase kinase, delta)
6	9606.ENSP00000291295	0.837	Calmodulin 3 (phosphorylase kinase, delta)
7	9606.ENSP00000349467	0.837	Calmodulin-1
8	9606.ENSP00000304643	0.830	Calmodulin-like protein 6
9	9606.ENSP00000315299	0.830	Calmodulin-like protein 3
10	9606.ENSP00000369689	0.830	Calmodulin-like protein 5
11	9606.ENSP00000419081	0.830	Calmodulin-like protein 4
12	9606.ENSP00000164139	0.790	Glycogen phosphorylase, muscle form
13	9606.ENSP00000216962	0.736	Glycogen phosphorylase, brain form
14	9606.ENSP00000238994	0.722	Protein phosphatase 1 regulatory subunit 3C
15	9606.ENSP00000308318	0.705	Protein phosphatase 1 regulatory subunit 3B
16	9606.ENSP00000287878	0.679	5'-AMP-activated protein kinase subunit gamma-2
17	9606.ENSP00000388137	0.668	Metallophosphoesterase domain-containing protein 1
18	9606.ENSP00000346148	0.667	5'-AMP-activated protein kinase catalytic subunit alpha-1
19	9606.ENSP00000323867	0.662	5'-AMP-activated protein kinase subunit gamma-1
20	9606.ENSP00000284601	0.655	Protein phosphatase 1 regulatory subunit 3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004683	0.999	calmodulin-dependent protein kinase activity
GO:0043167	0.305	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0043170	0.998	macromolecule metabolic process
GO:0044260	0.988	cellular macromolecule metabolic process
GO:0005975	0.987	carbohydrate metabolic process
GO:0005977	0.980	glycogen metabolic process
GO:1901564	0.965	organonitrogen compound metabolic process
GO:0006796	0.956	phosphate-containing compound metabolic process
GO:0036211	0.916	protein modification process
GO:0016310	0.894	phosphorylation
GO:0050789	0.855	regulation of biological process
GO:0050794	0.802	regulation of cellular process
GO:0006468	0.791	protein phosphorylation
GO:0019222	0.422	regulation of metabolic process
GO:0060255	0.362	regulation of macromolecule metabolic process
GO:0050896	0.304	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0032991	0.986	protein-containing complex
GO:1902494	0.965	catalytic complex
GO:1990234	0.962	transferase complex
GO:1902911	0.900	protein kinase complex
GO:0043226	0.451	organelle
GO:0043229	0.372	intracellular organelle
GO:0043227	0.355	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.17	0.999	calcium/calmodulin-dependent protein kinase.

[back to server]