StarFunc result for job id P15812

User Input

>input (388 residues)
MLLLFLLFEGLCCPGENTAAPQALQSYHLAAEEQLSFRMLQTSSFANHSWAHSEGSGWLG
DLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLEYP
FEIQILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNICKVLNRYLDIKE
ILQSLLGHTCPRFLAGLMEAGESELKRKVKPEAWLSCGPSPGPGRLQLVCHVSGFYPKPV
WVMWMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEAAGLSCRVKHSSLGGHDLIIH
WGGYSIFLILICLTVIVTLVILVVVDSRLKKQSSNKNILSPHTPSPVFLMGANTQDTKNS
RHQFCLAQVSWIKNRVLKKWKTRLNQLW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15812	1.000	1.000	3.481E-73	388	1.000	1.000	P15812.pdb.gz	CD1E_HUMAN T-cell surface glycoprotein CD1e, membrane-associated OS=Homo sapiens OX=9606 GN=CD1E PE=1 SV=2
2	PDB:3s6cA	0.678	0.707	4.694E-46	372	0.686	0.715	3s6cA.pdb.gz
3	AFDB:P06126	0.716	0.842	2.779E-43	327	0.451	0.535	P06126.pdb.gz	CD1A_HUMAN T-cell surface glycoprotein CD1a OS=Homo sapiens OX=9606 GN=CD1A PE=1 SV=4
4	AFDB:P29016	0.694	0.805	2.779E-43	333	0.459	0.535	P29016.pdb.gz	CD1B_HUMAN T-cell surface glycoprotein CD1b OS=Homo sapiens OX=9606 GN=CD1B PE=1 SV=1
5	AFDB:P15813	0.701	0.809	4.535E-43	335	0.443	0.513	P15813.pdb.gz	CD1D_HUMAN Antigen-presenting glycoprotein CD1d OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
6	AFDB:P29017	0.717	0.833	1.422E-42	333	0.451	0.526	P29017.pdb.gz	CD1C_HUMAN T-cell surface glycoprotein CD1c OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=2
7	AFDB:P11609	0.728	0.835	3.806E-39	336	0.418	0.482	P11609.pdb.gz	CD1D1_MOUSE Antigen-presenting glycoprotein CD1d1 OS=Mus musculus OX=10090 GN=Cd1d1 PE=1 SV=3
8	PDB:3ov6A	0.656	0.676	1.118E-35	376	0.420	0.434	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
9	PDB:1cd1A	0.658	0.927	1.253E-32	273	0.381	0.542	1cd1A.pdb.gz
10	AFDB:A0ZXM3	0.609	0.656	4.664E-25	357	0.188	0.204	A0ZXM3.pdb.gz	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
11	AFDB:U3PTD3	0.608	0.677	3.896E-24	344	0.178	0.201	U3PTD3.pdb.gz	U3PTD3_CHICK MHC class I alpha OS=Gallus gallus OX=9031 PE=2 SV=1
12	AFDB:Q6MGB8	0.584	0.615	5.031E-23	366	0.178	0.189	Q6MGB8.pdb.gz	Q6MGB8_RAT RT1 class I, A2 OS=Rattus norvegicus OX=10116 GN=RT1-A2 PE=2 SV=1
13	AFDB:Q8HWF3	0.571	0.626	5.312E-23	350	0.173	0.191	Q8HWF3.pdb.gz
14	PDB:5j6hA	0.558	0.757	4.228E-20	275	0.147	0.207	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
15	PDB:6fgbA	0.593	0.848	2.841E-19	265	0.155	0.226	6fgbA.pdb.gz
16	PDB:6e1iA	0.553	0.552	1.170E-18	389	0.139	0.139	6e1iA.pdb.gz
17	PDB:3es6A	0.555	0.746	1.712E-18	277	0.157	0.220	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
18	PDB:6d7gA	0.545	0.547	1.712E-18	386	0.139	0.140	6d7gA.pdb.gz
19	PDB:6mp0A	0.556	0.556	1.982E-17	388	0.134	0.134	6mp0A.pdb.gz
20	PDB:2qriA	0.589	0.575	2.748E-17	398	0.134	0.131	2qriA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15812	0.0	802	388	1.000	1.000	CD1E_HUMAN T-cell surface glycoprotein CD1e, membrane-associated OS=Homo sapiens OX=9606 GN=CD1E PE=1 SV=2
2	P15813	4.01e-122	358	335	0.454	0.525	CD1D_HUMAN Antigen-presenting glycoprotein CD1d OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
3	P29016	2.74e-119	351	333	0.454	0.529	CD1B_HUMAN T-cell surface glycoprotein CD1b OS=Homo sapiens OX=9606 GN=CD1B PE=1 SV=1
4	P06126	2.44e-117	345	327	0.441	0.523	CD1A_HUMAN T-cell surface glycoprotein CD1a OS=Homo sapiens OX=9606 GN=CD1A PE=1 SV=4
5	P29017	3.75e-114	338	333	0.430	0.502	CD1C_HUMAN T-cell surface glycoprotein CD1c OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=2
6	P11609	1.56e-104	313	336	0.415	0.479	CD1D1_MOUSE Antigen-presenting glycoprotein CD1d1 OS=Mus musculus OX=10090 GN=Cd1d1 PE=1 SV=3
7	P11610	3.84e-99	300	336	0.405	0.467	CD1D2_MOUSE Antigen-presenting glycoprotein CD1d2 OS=Mus musculus OX=10090 GN=Cd1d2 PE=1 SV=2
8	H0Y6Y6	3.15e-86	265	281	0.322	0.445	H0Y6Y6_HUMAN CD1c molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=1
9	H7C0I2	4.71e-82	253	246	0.314	0.496	H7C0I2_HUMAN CD1b molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD1B PE=1 SV=1
10	A0A669KB34	8.30e-48	164	242	0.211	0.339	A0A669KB34_HUMAN CD1d molecule OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
11	A0ZXM3	3.62e-16	81.3	357	0.157	0.171	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
12	O46789	2.31e-15	79.0	355	0.137	0.149	O46789_CHICK MHC class I alpha chain 2 OS=Gallus gallus OX=9031 GN=B-FIV PE=1 SV=1
13	U3PTD3	2.55e-15	78.6	344	0.131	0.148	U3PTD3_CHICK MHC class I alpha OS=Gallus gallus OX=9031 PE=2 SV=1
14	Q95601	1.96e-14	76.3	355	0.131	0.144	Q95601_CHICK MHC class I alpha chain 2 OS=Gallus gallus OX=9031 GN=BFIV21 PE=1 SV=1
15	F1CN43	5.61e-13	71.6	344	0.101	0.113	F1CN43_CHICK MHC class I antigen OS=Gallus gallus OX=9031 PE=2 SV=1
16	O46790	2.45e-12	69.7	355	0.098	0.107	O46790_CHICK MHC class I alpha chain 2 OS=Gallus gallus OX=9031 GN=B-FIV PE=1 SV=1
17	P55899	4.81e-11	65.9	365	0.170	0.181	FCGRN_HUMAN IgG receptor FcRn large subunit p51 OS=Homo sapiens OX=9606 GN=FCGRT PE=1 SV=1
18	Q6MGB8	8.41e-11	65.1	366	0.191	0.202	Q6MGB8_RAT RT1 class I, A2 OS=Rattus norvegicus OX=10116 GN=RT1-A2 PE=2 SV=1
19	Q95460	1.42e-10	64.3	341	0.180	0.205	HMR1_HUMAN Major histocompatibility complex class I-related gene protein OS=Homo sapiens OX=9606 GN=MR1 PE=1 SV=1
20	P25311	3.55e-10	62.8	298	0.144	0.188	ZA2G_HUMAN Zinc-alpha-2-glycoprotein OS=Homo sapiens OX=9606 GN=AZGP1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	1.9e-07	42.7	Immunoglobulin C1-set domain
2	PF13927 Ig_3	4.5e+02	12.8	Immunoglobulin domain
3	PF00129 MHC_I	3.7e+02	12.1	Class I Histocompatibility antigen, domains alpha 1 and 2
4	PF16497 MHC_I_3	8.2e-66	232.8	MHC-I family domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357149

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368450	0.872	CD83 antigen
2	9606.ENSP00000386378	0.868	C-type lectin domain family 4 member K
3	9606.ENSP00000250092	0.862	Macrosialin
4	9606.ENSP00000452780	0.842	Beta-2-microglobulin
5	9606.ENSP00000332049	0.827	T-lymphocyte activation antigen CD86
6	9606.ENSP00000357150	0.785	T-cell surface glycoprotein CD1b
7	9606.ENSP00000011653	0.783	T-cell surface glycoprotein CD4
8	9606.ENSP00000264246	0.774	T-lymphocyte activation antigen CD80
9	9606.ENSP00000342681	0.747	T-cell surface glycoprotein CD5
10	9606.ENSP00000386559	0.744	T-cell surface glycoprotein CD8 alpha chain
11	9606.ENSP00000296871	0.740	Granulocyte-macrophage colony-stimulating factor
12	9606.ENSP00000310036	0.738	Hematopoietic progenitor cell antigen CD34
13	9606.ENSP00000395473	0.720	Lysosomal alpha-mannosidase
14	9606.ENSP00000454623	0.720	Integrin alpha-X
15	9606.ENSP00000361359	0.719	Tumor necrosis factor receptor superfamily member 5
16	9606.ENSP00000231449	0.718	Interleukin-4
17	9606.ENSP00000312027	0.715	T-cell antigen CD7
18	9606.ENSP00000315477	0.710	CD209 antigen
19	9606.ENSP00000358490	0.694	T-cell surface antigen CD2
20	9606.ENSP00000352071	0.690	Scavenger receptor cysteine-rich type 1 protein M130

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003823	0.813	antigen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0048518	0.972	positive regulation of biological process
GO:0032501	0.970	multicellular organismal process
GO:0050896	0.967	response to stimulus
GO:0002376	0.955	immune system process
GO:0048522	0.928	positive regulation of cellular process
GO:0001775	0.905	cell activation
GO:0032502	0.865	developmental process
GO:0048583	0.855	regulation of response to stimulus
GO:0002682	0.792	regulation of immune system process
GO:0045321	0.788	leukocyte activation
GO:0002684	0.745	positive regulation of immune system process
GO:0048856	0.732	anatomical structure development
GO:0051239	0.727	regulation of multicellular organismal process
GO:0046649	0.688	lymphocyte activation
GO:0050776	0.661	regulation of immune response
GO:0051240	0.531	positive regulation of multicellular organismal process
GO:0048584	0.513	positive regulation of response to stimulus
GO:0002694	0.419	regulation of leukocyte activation
GO:0019222	0.416	regulation of metabolic process
GO:0060255	0.407	regulation of macromolecule metabolic process
GO:0042127	0.395	regulation of cell population proliferation
GO:0006955	0.388	immune response
GO:0030155	0.359	regulation of cell adhesion
GO:0042110	0.329	T cell activation
GO:0009893	0.322	positive regulation of metabolic process
GO:0051249	0.319	regulation of lymphocyte activation
GO:0048519	0.316	negative regulation of biological process
GO:0010604	0.305	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005794	0.980	Golgi apparatus
GO:0005886	0.967	plasma membrane
GO:0070013	0.770	intracellular organelle lumen
GO:0031981	0.687	nuclear lumen
GO:0043232	0.667	intracellular non-membrane-bounded organelle
GO:0009986	0.438	cell surface
GO:0005654	0.346	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]