StarFunc result for job id P15813

User Input

>input (335 residues)
MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSN
DSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGC
EVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLL
NGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMR
GEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYT
SMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15813	1.000	1.000	3.445E-64	335	1.000	1.000	P15813.pdb.gz	CD1D_HUMAN Antigen-presenting glycoprotein CD1d OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
2	AFDB:P11609	0.826	0.824	8.604E-47	336	0.615	0.613	P11609.pdb.gz	CD1D1_MOUSE Antigen-presenting glycoprotein CD1d1 OS=Mus musculus OX=10090 GN=Cd1d1 PE=1 SV=3
3	AFDB:P15812	0.812	0.704	1.219E-41	388	0.528	0.456	P15812.pdb.gz	CD1E_HUMAN T-cell surface glycoprotein CD1e, membrane-associated OS=Homo sapiens OX=9606 GN=CD1E PE=1 SV=2
4	AFDB:P06126	0.815	0.835	4.843E-39	327	0.484	0.495	P06126.pdb.gz	CD1A_HUMAN T-cell surface glycoprotein CD1a OS=Homo sapiens OX=9606 GN=CD1A PE=1 SV=4
5	AFDB:P29016	0.813	0.818	5.394E-39	333	0.510	0.514	P29016.pdb.gz	CD1B_HUMAN T-cell surface glycoprotein CD1b OS=Homo sapiens OX=9606 GN=CD1B PE=1 SV=1
6	AFDB:P29017	0.816	0.820	1.864E-38	333	0.472	0.474	P29017.pdb.gz	CD1C_HUMAN T-cell surface glycoprotein CD1c OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=2
7	AFDB:A0A669KB34	0.564	0.777	9.396E-38	242	0.719	0.996	A0A669KB34.pdb.gz	A0A669KB34_HUMAN CD1d molecule OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
8	PDB:1cd1A	0.786	0.962	9.700E-38	273	0.528	0.648	1cd1A.pdb.gz
9	PDB:3s6cA	0.767	0.692	6.712E-34	372	0.478	0.430	3s6cA.pdb.gz
10	PDB:3ov6A	0.764	0.684	1.428E-33	376	0.469	0.418	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
11	AFDB:A0ZXM3	0.695	0.657	7.733E-23	357	0.200	0.188	A0ZXM3.pdb.gz	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
12	AFDB:U3PTD3	0.686	0.670	1.069E-22	344	0.185	0.180	U3PTD3.pdb.gz	U3PTD3_CHICK MHC class I alpha OS=Gallus gallus OX=9031 PE=2 SV=1
13	AFDB:Q30201	0.732	0.707	1.256E-22	348	0.254	0.244	Q30201.pdb.gz	HFE_HUMAN Hereditary hemochromatosis protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
14	PDB:6fgbA	0.691	0.860	3.729E-20	265	0.188	0.238	6fgbA.pdb.gz
15	PDB:5j6hA	0.657	0.783	1.382E-18	275	0.167	0.204	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
16	PDB:3es6A	0.664	0.787	2.369E-18	277	0.185	0.224	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
17	PDB:6d7gA	0.633	0.560	3.646E-18	386	0.164	0.142	6d7gA.pdb.gz
18	PDB:6e1iA	0.640	0.562	4.061E-18	389	0.167	0.144	6e1iA.pdb.gz
19	PDB:6mp0A	0.652	0.572	2.047E-17	388	0.158	0.137	6mp0A.pdb.gz
20	PDB:3nwmA	0.657	0.581	2.580E-16	384	0.164	0.143	3nwmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15813	0.0	684	335	1.000	1.000	CD1D_HUMAN Antigen-presenting glycoprotein CD1d OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
2	P11609	1.64e-148	423	336	0.618	0.616	CD1D1_MOUSE Antigen-presenting glycoprotein CD1d1 OS=Mus musculus OX=10090 GN=Cd1d1 PE=1 SV=3
3	A0A669KB34	4.12e-147	416	242	0.603	0.835	A0A669KB34_HUMAN CD1d molecule OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
4	P11610	2.13e-146	417	336	0.621	0.619	CD1D2_MOUSE Antigen-presenting glycoprotein CD1d2 OS=Mus musculus OX=10090 GN=Cd1d2 PE=1 SV=2
5	P15812	6.75e-117	345	388	0.531	0.459	CD1E_HUMAN T-cell surface glycoprotein CD1e, membrane-associated OS=Homo sapiens OX=9606 GN=CD1E PE=1 SV=2
6	P29016	6.58e-111	327	333	0.507	0.511	CD1B_HUMAN T-cell surface glycoprotein CD1b OS=Homo sapiens OX=9606 GN=CD1B PE=1 SV=1
7	P06126	3.36e-110	325	327	0.472	0.483	CD1A_HUMAN T-cell surface glycoprotein CD1a OS=Homo sapiens OX=9606 GN=CD1A PE=1 SV=4
8	P29017	1.02e-104	311	333	0.475	0.477	CD1C_HUMAN T-cell surface glycoprotein CD1c OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=2
9	H0Y6Y6	1.23e-82	253	281	0.373	0.445	H0Y6Y6_HUMAN CD1c molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=1
10	H7C0I2	1.01e-70	222	246	0.337	0.459	H7C0I2_HUMAN CD1b molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD1B PE=1 SV=1
11	P70387	5.12e-18	85.9	359	0.236	0.220	HFE_MOUSE Hereditary hemochromatosis protein homolog OS=Mus musculus OX=10090 GN=Hfe PE=1 SV=2
12	Q95460	2.06e-17	84.0	341	0.200	0.196	HMR1_HUMAN Major histocompatibility complex class I-related gene protein OS=Homo sapiens OX=9606 GN=MR1 PE=1 SV=1
13	O46789	4.05e-17	83.2	355	0.152	0.144	O46789_CHICK MHC class I alpha chain 2 OS=Gallus gallus OX=9031 GN=B-FIV PE=1 SV=1
14	Q95601	6.86e-17	82.8	355	0.155	0.146	Q95601_CHICK MHC class I alpha chain 2 OS=Gallus gallus OX=9031 GN=BFIV21 PE=1 SV=1
15	U3PTD3	1.08e-16	82.0	344	0.158	0.154	U3PTD3_CHICK MHC class I alpha OS=Gallus gallus OX=9031 PE=2 SV=1
16	A0ZXM3	1.41e-16	81.6	357	0.155	0.146	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
17	F8W7W8	1.83e-16	81.3	337	0.200	0.199	F8W7W8_HUMAN Homeostatic iron regulator OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
18	Q30201	1.89e-16	81.3	348	0.200	0.193	HFE_HUMAN Hereditary hemochromatosis protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
19	Q6B0J5	4.97e-16	80.1	345	0.203	0.197	Q6B0J5_HUMAN HFE protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
20	O35799	2.36e-15	78.2	360	0.224	0.208	HFE_RAT Hereditary hemochromatosis protein homolog OS=Rattus norvegicus OX=10116 GN=Hfe PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	5.5e-08	44.4	Immunoglobulin C1-set domain
2	PF13927 Ig_3	5.7e+02	12.5	Immunoglobulin domain
3	PF07646 Kelch_2	4.1e+02	12.5	Kelch motif
4	PF00129 MHC_I	0.0073	27.4	Class I Histocompatibility antigen, domains alpha 1 and 2
5	PF16497 MHC_I_3	2.7e-93	322.5	MHC-I family domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357153

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000452780	0.999	Beta-2-microglobulin
2	9606.ENSP00000386559	0.942	T-cell surface glycoprotein CD8 alpha chain
3	9606.ENSP00000011653	0.935	T-cell surface glycoprotein CD4
4	9606.ENSP00000368450	0.858	CD83 antigen
5	9606.ENSP00000332049	0.844	T-lymphocyte activation antigen CD86
6	9606.ENSP00000386378	0.843	C-type lectin domain family 4 member K
7	9606.ENSP00000250092	0.820	Macrosialin
8	9606.ENSP00000411355	0.813	Receptor-type tyrosine-protein phosphatase C
9	9606.ENSP00000231449	0.811	Interleukin-4
10	9606.ENSP00000264246	0.805	T-lymphocyte activation antigen CD80
11	9606.ENSP00000361359	0.802	Tumor necrosis factor receptor superfamily member 5
12	9606.ENSP00000342681	0.801	T-cell surface glycoprotein CD5
13	9606.ENSP00000247461	0.778	Calnexin
14	9606.ENSP00000354566	0.778	T-cell surface glycoprotein CD3 epsilon chain
15	9606.ENSP00000375629	0.769	Leukocyte immunoglobulin-like receptor subfamily B member 2
16	9606.ENSP00000437940	0.768	B-lymphocyte antigen CD19
17	9606.ENSP00000454623	0.763	Integrin alpha-X
18	9606.ENSP00000228434	0.755	Early activation antigen CD69
19	9606.ENSP00000275493	0.753	Epidermal growth factor receptor
20	9606.ENSP00000412237	0.744	Interleukin-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.998	lipid binding
GO:0003823	0.985	antigen binding
GO:0005102	0.489	signaling receptor binding
GO:0030882	0.444	lipid antigen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.996	regulation of biological process
GO:0050896	0.989	response to stimulus
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.989	positive regulation of biological process
GO:0002376	0.984	immune system process
GO:0048522	0.977	positive regulation of cellular process
GO:0048584	0.974	positive regulation of response to stimulus
GO:0032501	0.969	multicellular organismal process
GO:0042110	0.961	T cell activation
GO:0051239	0.948	regulation of multicellular organismal process
GO:0002682	0.937	regulation of immune system process
GO:0002684	0.926	positive regulation of immune system process
GO:0032502	0.925	developmental process
GO:0050776	0.917	regulation of immune response
GO:0051240	0.913	positive regulation of multicellular organismal process
GO:0050865	0.913	regulation of cell activation
GO:0070663	0.912	regulation of leukocyte proliferation
GO:0048856	0.908	anatomical structure development
GO:1903037	0.908	regulation of leukocyte cell-cell adhesion
GO:0045785	0.897	positive regulation of cell adhesion
GO:0050867	0.895	positive regulation of cell activation
GO:0050863	0.894	regulation of T cell activation
GO:0051251	0.891	positive regulation of lymphocyte activation
GO:0022409	0.869	positive regulation of cell-cell adhesion
GO:0050870	0.846	positive regulation of T cell activation
GO:0030097	0.843	hemopoiesis
GO:0002521	0.782	leukocyte differentiation
GO:0019222	0.739	regulation of metabolic process
GO:1903131	0.709	mononuclear cell differentiation
GO:0060255	0.678	regulation of macromolecule metabolic process
GO:0030098	0.648	lymphocyte differentiation
GO:0030217	0.609	T cell differentiation
GO:0045058	0.529	T cell selection
GO:0032944	0.527	regulation of mononuclear cell proliferation
GO:0051716	0.521	cellular response to stimulus
GO:0050778	0.483	positive regulation of immune response
GO:0010468	0.462	regulation of gene expression
GO:0010604	0.457	positive regulation of macromolecule metabolic process
GO:0009605	0.453	response to external stimulus
GO:0006955	0.452	immune response
GO:0001817	0.451	regulation of cytokine production
GO:0001819	0.413	positive regulation of cytokine production
GO:0008284	0.409	positive regulation of cell population proliferation
GO:0050670	0.395	regulation of lymphocyte proliferation
GO:0006950	0.385	response to stress
GO:0048519	0.368	negative regulation of biological process
GO:0007165	0.346	signal transduction
GO:0048523	0.337	negative regulation of cellular process
GO:0044419	0.325	biological process involved in interspecies interaction between organisms
GO:0032101	0.312	regulation of response to external stimulus
GO:0042129	0.305	regulation of T cell proliferation
GO:0080134	0.300	regulation of response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0009986	0.763	cell surface
GO:0005783	0.695	endoplasmic reticulum
GO:0000323	0.410	lytic vacuole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]