StarFunc result for job id P15822

User Input

>input (1400 residues)
MPRTKQIHPRNLRDKIEEAQKELNGAEVSKKEILQAGVKGTSESLKGVKRKKIVAENHLK
KIPKSPLRNPLQAKHKQNTEESSFAVLHSASESHKKQNYIPVKNGKQFTKQNGETPGIIA
EASKSEESVSPKKPLFLQQPSELRRWRSEGADPAKFSDLDEQCDSSSLSSKTRTDNSECI
SSHCGTTSPSYTNTAFDVLLKAMEPELSTLSQKGSPCAIKTEKLRPNKTARSPPKLKNSS
MDAPNQTSQELVAESQSSCTSYTVHMSAAQKNEQGAMQSASHLYHQHEHFVPKSNQHNQQ
LPGCSGFTGSLTNLQNQENAKLEQVYNIAVTSSVGLTSPSSRSQVTPQNQQMDSASPLSI
SPANSTQSPPMPIYNSTHVASVVNQSVEQMCNLLLKDQKPKKQGKYICEYCNRACAKPSV
LLKHIRSHTGERPYPCVTCGFSFKTKSNLYKHKKSHAHTIKLGLVLQPDAGGLFLSHESP
KALSIHSDVEDSGESEEEGATDERQHDLGAMELQPVHIIKRMSNAETLLKSSFTPSSPEN
VIGDFLLQDRSAESQAVTELPKVVVHHVTVSPLRTDSPKAMDPKPELSSAQKQKDLQVTN
VQPLSANMSQGGVSRLETNENSHQKGDMNPLEGKQDSHVGTVHAQLQRQQATDYSQEQQG
KLLSPRSLGSTDSGYFSRSESADQTVSPPTPFARRLPSTEQDSGRSNGPSAALVTTSTPS
ALPTGEKALLLPGQMRPPLATKTLEERISKLISDNEALVDDKQLDSVKPRRTSLSRRGSI
DSPKSYIFKDSFQFDLKPVGRRTSSSSDIPKSPFTPTEKSKQVFLLSVPSLDCLPITRSN
SMPTTGYSAVPANIIPPPHPLRGSQSFDDKIGTFYDDVFVSGPNAPVPQSGHPRTLVRQA
AIEDSSANESHVLGTGQSLDESHQGCHAAGEAMSVRSKALAQGPHIEKKKSHQGRGTMFE
CETCRNRYRKLENFENHKKFYCSELHGPKTKVAMREPEHSPVPGGLQPQILHYRVAGSSG
IWEQTPQIRKRRKMKSVGDDEELQQNESGTSPKSSEGLQFQNALGCNPSLPKHNVTIRSD
QQHKNIQLQNSHIHLVARGPEQTMDPKLSTIMEQQISSAAQDKIELQRHGTGISVIQHTN
SLSRPNSFDKPEPFERASPVSFQELNRTGKSGSLKVIGISQEESHPSRDGSHPHQLALSD
ALRGELQESSRKSPSERHVLGQPSRLVRQHNIQVPEILVTEEPDRDLEAQCHDQEKSEKF
SWPQRSETLSKLPTEKLPPKKKRLRLAEIEHSSTESSFDSTLSRSLSRESSLSHTSSFSA
SLDIEDVSKTEASPKIDFLNKAEFLMIPAGLNTLNVPGCHREMRRTASEQINCTQTSMEV
SDLRSKSFDCGSITPPQTTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1M9H4	0.039	0.031	4.006E-40	2110	0.412	0.273	F1M9H4.pdb.gz	F1M9H4_RAT HIVEP zinc finger 1 OS=Rattus norvegicus OX=10116 GN=Hivep1 PE=1 SV=3
2	AFDB:A2A884	0.059	0.038	3.023E-17	2348	0.269	0.160	A2A884.pdb.gz	ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus OX=10090 GN=Hivep3 PE=1 SV=1
3	AFDB:P31629	0.063	0.040	2.654E-14	2446	0.269	0.154	P31629.pdb.gz	ZEP2_HUMAN Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2
4	AFDB:Q5T1R4	0.073	0.048	1.519E-13	2406	0.276	0.160	Q5T1R4.pdb.gz	ZEP3_HUMAN Transcription factor HIVEP3 OS=Homo sapiens OX=9606 GN=HIVEP3 PE=1 SV=1
5	AFDB:A0A2R8QMX9	0.041	0.040	1.020E-10	1443	0.164	0.159	A0A2R8QMX9.pdb.gz
6	AFDB:Q5U0U1	0.059	0.064	1.631E-10	1267	0.134	0.148	Q5U0U1.pdb.gz	Q5U0U1_DROME AT17006p OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
7	AFDB:P10070	0.039	0.038	2.134E-10	1586	0.181	0.160	P10070.pdb.gz	GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens OX=9606 GN=GLI2 PE=1 SV=4
8	AFDB:A0A0R4INF0	0.048	0.045	2.282E-10	1570	0.177	0.158	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
9	AFDB:Q9IA31	0.042	0.036	6.113E-9	1544	0.155	0.141	Q9IA31.pdb.gz	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
10	AFDB:F1QH64	0.046	0.043	3.060E-8	1225	0.161	0.184	F1QH64.pdb.gz
11	PDB:3w5kB	0.033	0.258	1.199E-1	110	0.016	0.209	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4v6wCj	0.023	0.150	3.435	92	0.009	0.130	4v6wCj.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:7oniH	0.028	0.067	3.674	380	0.011	0.042	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
14	PDB:2jrxA	0.020	0.242	3.929	83	0.012	0.205	2jrxA.pdb.gz
15	PDB:3zqqC	0.029	0.141	3.929	134	0.009	0.090	3zqqC.pdb.gz
16	PDB:7l08c	0.031	0.075	4.493	289	0.010	0.048	7l08c.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
17	PDB:6gejS	0.023	0.107	5.495	208	0.011	0.072	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
18	PDB:7nacm	0.022	0.038	5.495	666	0.015	0.032	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
19	PDB:7kzfF	0.022	0.052	6.284	483	0.014	0.039	7kzfF.pdb.gz
20	PDB:6elzm	0.021	0.037	6.720	645	0.012	0.026	6elzm.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M9H4	0.0	1744	2574	0.674	0.366	F1M9H4_RAT HIVEP zinc finger 1 OS=Rattus norvegicus OX=10116 GN=Hivep1 PE=1 SV=3
2	F5H212	0.0	2872	2717	0.999	0.515	F5H212_HUMAN HIVEP zinc finger 1 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=2
3	F8VPM9	0.0	1969	2688	0.744	0.388	F8VPM9_MOUSE Human immunodeficiency virus type I enhancer binding protein 1 OS=Mus musculus OX=10090 GN=Hivep1 PE=1 SV=1
4	P15822	0.0	2872	2718	0.999	0.515	ZEP1_HUMAN Zinc finger protein 40 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=4
5	Q03172	0.0	1969	2688	0.744	0.388	ZEP1_MOUSE Zinc finger protein 40 OS=Mus musculus OX=10090 GN=Hivep1 PE=1 SV=1
6	Q00900	1.97e-72	270	2437	0.214	0.123	ZEP2_RAT Human immunodeficiency virus type I enhancer-binding protein 2 homolog OS=Rattus norvegicus OX=10116 GN=Hivep2 PE=1 SV=2
7	Q3UHF7	1.74e-71	267	2430	0.208	0.120	ZEP2_MOUSE Transcription factor HIVEP2 OS=Mus musculus OX=10090 GN=Hivep2 PE=1 SV=1
8	P31629	2.29e-71	267	2446	0.209	0.120	ZEP2_HUMAN Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2
9	Q5T1R4	1.79e-61	235	2406	0.199	0.116	ZEP3_HUMAN Transcription factor HIVEP3 OS=Homo sapiens OX=9606 GN=HIVEP3 PE=1 SV=1
10	A2A884	8.66e-32	138	2348	0.108	0.064	ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus OX=10090 GN=Hivep3 PE=1 SV=1
11	Q8MQL7	1.08e-22	106	585	0.032	0.077	Q8MQL7_DROME SD06302p OS=Drosophila melanogaster OX=7227 GN=shn PE=2 SV=1
12	A1Z8F4	8.17e-22	105	2577	0.032	0.017	A1Z8F4_DROME Schnurri, isoform D OS=Drosophila melanogaster OX=7227 GN=shn PE=1 SV=1
13	A0A0B4KFC0	8.24e-22	105	2587	0.032	0.017	A0A0B4KFC0_DROME Schnurri, isoform F OS=Drosophila melanogaster OX=7227 GN=shn PE=1 SV=1
14	Q24605	8.34e-22	105	2529	0.032	0.018	Q24605_DROME Zinc finger protein OS=Drosophila melanogaster OX=7227 GN=shn PE=2 SV=1
15	Q24107	8.70e-22	105	2527	0.032	0.018	Q24107_DROME Transcription factor OS=Drosophila melanogaster OX=7227 GN=shn PE=2 SV=1
16	Q0E9C5	8.85e-22	105	2532	0.032	0.018	Q0E9C5_DROME Schnurri, isoform A OS=Drosophila melanogaster OX=7227 GN=shn PE=1 SV=1
17	C9JLG1	4.69e-13	72.8	240	0.031	0.183	C9JLG1_HUMAN HIVEP zinc finger 1 (Fragment) OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=1
18	Q7JM44	1.13e-12	75.9	2242	0.022	0.014	SMA9_CAEEL Transcription factor sma-9 OS=Caenorhabditis elegans OX=6239 GN=sma-9 PE=1 SV=2
19	Q90W82	6.73e-10	65.9	563	0.020	0.050	Q90W82_CHICK IKAROS family zinc finger 2 OS=Gallus gallus OX=9031 GN=HELIOS PE=2 SV=1
20	F8VPL6	9.20e-10	65.5	540	0.020	0.052	F8VPL6_HUMAN IKAROS family zinc finger 4 OS=Homo sapiens OX=9606 GN=IKZF4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10396 TrmE_N	4.8e+02	12.5	GTP-binding protein TrmE N-terminus
2	PF00096 zf-C2H2	6.8e-05	34.2	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	2.5	20.1	C2H2-type zinc finger
4	PF12171 zf-C2H2_jaz	5.8	18.6	Zinc-finger double-stranded RNA-binding
5	PF13465 zf-H2C2_2	0.072	24.7	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368698

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327179	0.954	U3 small nucleolar RNA-associated protein 4 homolog
2	9606.ENSP00000359206	0.843	F-box/WD repeat-containing protein 1A
3	9606.ENSP00000368104	0.741	Bone morphogenetic protein 2
4	9606.ENSP00000368589	0.704	Belongs to the Gfo/Idh/MocA family
5	9606.ENSP00000265094	0.693	F-box/WD repeat-containing protein 11
6	9606.ENSP00000329880	0.679	Phosphatase and actin regulator 1
7	9606.ENSP00000222584	0.663	Transcription factor Sp4
8	9606.ENSP00000332973	0.648	Mothers against decapentaplegic homolog 3
9	9606.ENSP00000245451	0.643	Bone morphogenetic protein 4
10	9606.ENSP00000363500	0.604	Chloride intracellular channel protein 4
11	9606.ENSP00000367177	0.594	Protocadherin-8
12	9606.ENSP00000262160	0.591	Mothers against decapentaplegic homolog 2
13	9606.ENSP00000475727	0.587	TBC1 domain family member 7
14	9606.ENSP00000432172	0.573	Coiled-coil domain containing 17
15	9606.ENSP00000476228	0.548	NAD-dependent protein deacylase sirtuin-5, mitochondrial
16	9606.ENSP00000241416	0.541	Activin receptor type-2A
17	9606.ENSP00000340361	0.541	Activin receptor type-2B
18	9606.ENSP00000257829	0.540	RNA cytidine acetyltransferase
19	9606.ENSP00000268797	0.538	Glucose-fructose oxidoreductase domain-containing protein 2
20	9606.ENSP00000384524	0.537	ETS translocation variant 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.999	DNA binding
GO:0043565	0.745	sequence-specific DNA binding
GO:0003690	0.495	double-stranded DNA binding
GO:1990837	0.461	sequence-specific double-stranded DNA binding
GO:0140110	0.436	transcription regulator activity
GO:0003700	0.414	DNA-binding transcription factor activity
GO:0000976	0.344	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0045892	0.992	negative regulation of DNA-templated transcription
GO:0006357	0.949	regulation of transcription by RNA polymerase II
GO:0000122	0.730	negative regulation of transcription by RNA polymerase II
GO:0009987	0.652	cellular process
GO:0048518	0.421	positive regulation of biological process
GO:0048522	0.331	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0005654	0.993	nucleoplasm
GO:0005829	0.988	cytosol
GO:0005739	0.671	mitochondrion
GO:0016604	0.658	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]