StarFunc result for job id P15863

User Input

>input (534 residues)
MKFTLGLGSRAWRVSWEGAAAAAAGPGAGGSALRCRAQRVSSPRLGRRGSRLSGALPLCL
SRGGGGAQALPDCAGPSPGHPGHPGARQLAGPLAMEQTYGEVNQLGGVFVNGRPLPNAIR
LRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPNVVKH
IRDYKQGDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGSLAQPGPYEASKQP
PSQPTLPYNHIYQYPYPSPVSPTGAKMGSHPGVPGTAGHVSIPRSWPSAHSVSNILGIRT
FMEQTGALAGSEGTAYSPKMEDWAGVNRTAFPATPAVNGLEKPALEADIKYTQSASTLSA
VGGFLPACAYPASNQHGVYSAPGGGYLAPGPPWPPAQGPPLAPPGAGVAVHGGELAAAMT
FKHPSREGSLPAPAARPRTPSVAYTDCPSRPRPPRGSSPRTRARRERQADPGAQVCAAAP
AIGTGRIGGLAEEEASAGPRGARPASPQAQPCLWPDPPHFLYWSGFLGFSELGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15863	0.999	0.999	2.613E-75	534	1.000	1.000	P15863.pdb.gz	PAX1_HUMAN Paired box protein Pax-1 OS=Homo sapiens OX=9606 GN=PAX1 PE=1 SV=4
2	AFDB:A0A2R8PYI0	0.263	0.392	5.163E-33	353	0.429	0.649	A0A2R8PYI0.pdb.gz
3	AFDB:P47242	0.272	0.415	1.616E-31	342	0.410	0.640	P47242.pdb.gz	PAX9_MOUSE Paired box protein Pax-9 OS=Mus musculus OX=10090 GN=Pax9 PE=2 SV=1
4	AFDB:Q98865	0.265	0.407	4.513E-31	343	0.375	0.583	Q98865.pdb.gz	Q98865_DANRE Paired box 9 OS=Danio rerio OX=7955 GN=Pax9 PE=2 SV=1
5	AFDB:Q98866	0.259	0.492	1.573E-27	270	0.326	0.644	Q98866.pdb.gz	Q98866_DANRE Paired box 9 OS=Danio rerio OX=7955 GN=Pax9 PE=2 SV=1
6	AFDB:F1R139	0.253	0.346	2.781E-22	386	0.273	0.378	F1R139.pdb.gz
7	AFDB:Q02548	0.246	0.334	8.765E-22	391	0.279	0.381	Q02548.pdb.gz	PAX5_HUMAN Paired box protein Pax-5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1
8	AFDB:Q59DP0	0.242	0.191	1.604E-21	680	0.300	0.235	Q59DP0.pdb.gz	Q59DP0_DROME Shaven, isoform D OS=Drosophila melanogaster OX=7227 GN=sv PE=4 SV=1
9	AFDB:Q8IM96	0.245	0.204	3.311E-21	647	0.283	0.233	Q8IM96.pdb.gz	Q8IM96_DROME Shaven, isoform C OS=Drosophila melanogaster OX=7227 GN=sv PE=4 SV=3
10	AFDB:Q02962	0.255	0.323	3.969E-21	417	0.277	0.355	Q02962.pdb.gz	PAX2_HUMAN Paired box protein Pax-2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=4
11	PDB:2avuE	0.068	0.213	7.216E-2	156	0.043	0.147	2avuE.pdb.gz	Structure of the Escherichia coli FlhDC Complex, a Prokaryotic Heteromeric Regulator of Transcription.
12	PDB:5lzbz	0.079	0.071	9.760E-2	614	0.043	0.037	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
13	PDB:7cpuSN	0.066	0.204	1.037E-1	150	0.052	0.187	7cpuSN.pdb.gz	A male germ-cell-specific ribosome controls male fertility.
14	PDB:4v6wAN	0.078	0.231	1.681E-1	150	0.060	0.213	4v6wAN.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:7a1gY	0.069	0.221	1.786E-1	150	0.043	0.153	7a1gY.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
16	PDB:2gqqC	0.079	0.239	2.141E-1	157	0.030	0.102	2gqqC.pdb.gz
17	PDB:7pzyO	0.078	0.233	2.274E-1	150	0.052	0.187	7pzyO.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
18	PDB:2cg4A	0.078	0.245	2.416E-1	149	0.041	0.148	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
19	PDB:6rw4O	0.068	0.149	5.298E-1	194	0.067	0.186	6rw4O.pdb.gz	Distinct pre-initiation steps in human mitochondrial translation.
20	PDB:5aj0BZ	0.083	0.427	6.747E-1	86	0.017	0.105	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09084	0.0	692	446	0.717	0.859	PAX1_MOUSE Paired box protein Pax-1 OS=Mus musculus OX=10090 GN=Pax1 PE=1 SV=4
2	P15863	0.0	1061	534	1.000	1.000	PAX1_HUMAN Paired box protein Pax-1 OS=Homo sapiens OX=9606 GN=PAX1 PE=1 SV=4
3	B0S7C8	1.02e-152	442	340	0.427	0.671	B0S7C8_DANRE Paired box 1b OS=Danio rerio OX=7955 GN=pax1b PE=4 SV=1
4	P55771	8.29e-135	396	341	0.416	0.651	PAX9_HUMAN Paired box protein Pax-9 OS=Homo sapiens OX=9606 GN=PAX9 PE=1 SV=3
5	Q2L4T1	8.29e-135	396	341	0.416	0.651	Q2L4T1_HUMAN Paired box gene 9 OS=Homo sapiens OX=9606 GN=Pax9 PE=2 SV=1
6	P47242	3.86e-129	382	342	0.408	0.637	PAX9_MOUSE Paired box protein Pax-9 OS=Mus musculus OX=10090 GN=Pax9 PE=2 SV=1
7	Q98865	2.88e-127	377	343	0.382	0.595	Q98865_DANRE Paired box 9 OS=Danio rerio OX=7955 GN=Pax9 PE=2 SV=1
8	Q98866	7.40e-114	340	270	0.318	0.630	Q98866_DANRE Paired box 9 OS=Danio rerio OX=7955 GN=Pax9 PE=2 SV=1
9	P23757	3.65e-74	241	370	0.215	0.311	POXM_DROME Paired box pox-meso protein OS=Drosophila melanogaster OX=7227 GN=Poxm PE=2 SV=3
10	O93370	9.65e-62	209	386	0.189	0.262	O93370_DANRE Paired box 2b OS=Danio rerio OX=7955 GN=Pax2.2 PE=2 SV=1
11	E7ERW5	4.61e-61	204	295	0.215	0.390	E7ERW5_HUMAN Paired box 5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1
12	E7EQT0	1.29e-60	204	324	0.215	0.355	E7EQT0_HUMAN Paired box 5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1
13	O57682	3.02e-60	208	494	0.184	0.198	PAX2B_XENLA Paired box protein Pax-2-B OS=Xenopus laevis OX=8355 GN=pax2-b PE=2 SV=2
14	Q02650	3.14e-60	206	391	0.217	0.297	PAX5_MOUSE Paired box protein Pax-5 OS=Mus musculus OX=10090 GN=Pax5 PE=1 SV=1
15	Q02548	4.12e-60	205	391	0.215	0.294	PAX5_HUMAN Paired box protein Pax-5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1
16	A0A0A0MRH7	5.19e-60	205	393	0.182	0.247	A0A0A0MRH7_HUMAN Paired box 2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=1
17	Q21272	5.85e-60	200	257	0.170	0.354	PAX1H_CAEEL Paired box protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=pax-1 PE=2 SV=1
18	Q0IH87	7.18e-60	207	483	0.180	0.199	PAX3B_XENLA Paired box protein Pax-3-B OS=Xenopus laevis OX=8355 GN=pax3-b PE=2 SV=2
19	P32114	8.77e-60	205	414	0.182	0.234	PAX2_MOUSE Paired box protein Pax-2 OS=Mus musculus OX=10090 GN=Pax2 PE=1 SV=2
20	Q9PTX1	1.19e-59	204	394	0.182	0.246	Q9PTX1_CHICK Paired-box containing protein Pax-2 OS=Gallus gallus OX=9031 GN=Pax-2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13384 HTH_23	0.001	30.1	Homeodomain-like domain
2	PF13551 HTH_29	1.1e+02	14.2	Winged helix-turn helix
3	PF13565 HTH_32	0.059	25.3	Homeodomain-like domain
4	PF00292 PAX	7.9e-63	221.4	'Paired box' domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381499

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301310	0.737	Zinc finger protein 582
2	9606.ENSP00000314480	0.713	Homeobox protein unc-4 homolog
3	9606.ENSP00000371875	0.709	Homeobox protein Nkx-3.2
4	9606.ENSP00000321684	0.699	Homeobox protein MOX-1
5	9606.ENSP00000351446	0.697	WD repeat-containing protein 5
6	9606.ENSP00000246080	0.677	Transcription factor 15
7	9606.ENSP00000266058	0.668	Slit homolog 1 protein
8	9606.ENSP00000436881	0.668	Homeobox protein DBX1
9	9606.ENSP00000258106	0.665	Homeobox protein EMX1
10	9606.ENSP00000389588	0.661	Semaphorin-5B
11	9606.ENSP00000354478	0.654	Homeobox protein DLX-1
12	9606.ENSP00000265361	0.652	Semaphorin-3C
13	9606.ENSP00000304331	0.616	GS homeobox 1
14	9606.ENSP00000295400	0.610	Protransforming growth factor alpha
15	9606.ENSP00000484411	0.608	Homeobox protein Hox-A3
16	9606.ENSP00000262426	0.606	Forkhead box protein F1
17	9606.ENSP00000173229	0.597	Netrin-1
18	9606.ENSP00000476384	0.585	Basic helix-loop-helix transcription factor scleraxis
19	9606.ENSP00000265362	0.580	Semaphorin-3A
20	9606.ENSP00000330218	0.579	Transcription factor SOX-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.865	protein binding
GO:0140110	0.734	transcription regulator activity
GO:0000976	0.728	transcription cis-regulatory region binding
GO:0003700	0.696	DNA-binding transcription factor activity
GO:0000981	0.448	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0032501	0.994	multicellular organismal process
GO:0048856	0.993	anatomical structure development
GO:0009987	0.986	cellular process
GO:0007275	0.976	multicellular organism development
GO:0048731	0.922	system development
GO:0071704	0.810	organic substance metabolic process
GO:0044238	0.795	primary metabolic process
GO:0044237	0.795	cellular metabolic process
GO:0050794	0.778	regulation of cellular process
GO:0006807	0.734	nitrogen compound metabolic process
GO:0043170	0.691	macromolecule metabolic process
GO:0019222	0.606	regulation of metabolic process
GO:0060255	0.593	regulation of macromolecule metabolic process
GO:0031323	0.587	regulation of cellular metabolic process
GO:0080090	0.570	regulation of primary metabolic process
GO:0010468	0.552	regulation of gene expression
GO:0051171	0.525	regulation of nitrogen compound metabolic process
GO:0019219	0.522	regulation of nucleobase-containing compound metabolic process
GO:0019438	0.520	aromatic compound biosynthetic process
GO:0018130	0.520	heterocycle biosynthetic process
GO:0006139	0.516	nucleobase-containing compound metabolic process
GO:0010556	0.515	regulation of macromolecule biosynthetic process
GO:0031326	0.515	regulation of cellular biosynthetic process
GO:0006355	0.507	regulation of DNA-templated transcription
GO:1901362	0.496	organic cyclic compound biosynthetic process
GO:0009059	0.496	macromolecule biosynthetic process
GO:0044271	0.493	cellular nitrogen compound biosynthetic process
GO:0010467	0.492	gene expression
GO:0090304	0.489	nucleic acid metabolic process
GO:0006351	0.472	DNA-templated transcription
GO:0048518	0.428	positive regulation of biological process
GO:0048522	0.404	positive regulation of cellular process
GO:0048513	0.381	animal organ development
GO:0001501	0.338	skeletal system development
GO:0050896	0.329	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.983	nuclear lumen
GO:0005654	0.969	nucleoplasm
GO:0032991	0.913	protein-containing complex
GO:0005667	0.324	transcription regulator complex
GO:0005737	0.303	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]