StarFunc result for job id P15884

User Input

>input (667 residues)
MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWG
NGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQG
CHQQSLLGGDMDMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGL
PSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAG
MLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA
NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTA
VWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG
IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQ
SATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKD
IKSITSNNDDEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKP
QTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDA
SNHMGQM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q60722	0.320	0.319	2.642E-84	670	0.979	0.975	Q60722.pdb.gz	ITF2_MOUSE Transcription factor 4 OS=Mus musculus OX=10090 GN=Tcf4 PE=1 SV=1
2	AFDB:E2J8V4	0.175	0.173	1.602E-62	677	0.765	0.753	E2J8V4.pdb.gz
3	AFDB:P51514	0.215	0.204	3.084E-54	707	0.649	0.612	P51514.pdb.gz	HTF4_RAT Transcription factor 12 OS=Rattus norvegicus OX=10116 GN=Tcf12 PE=1 SV=1
4	AFDB:A0A024R5T1	0.149	0.146	2.281E-53	682	0.654	0.639	A0A024R5T1.pdb.gz
5	AFDB:F7BGG6	0.154	0.148	2.121E-49	702	0.619	0.588	F7BGG6.pdb.gz	F7BGG6_XENTR Transcription factor 12 (HTF4, helix-loop-helix transcription factors 4) OS=Xenopus tropicalis OX=8364 GN=tcf12 PE=4 SV=4
6	AFDB:Q6QR58	0.173	0.166	1.120E-46	705	0.591	0.559	Q6QR58.pdb.gz	Q6QR58_ICTPU E-box binding protein 1 OS=Ictalurus punctatus OX=7998 GN=tcf12 PE=2 SV=1
7	AFDB:Q70IK3	0.156	0.155	8.287E-46	669	0.576	0.574	Q70IK3.pdb.gz	Q70IK3_CHICK Helix-loop-helix protein E12 OS=Gallus gallus OX=9031 GN=TCF3 PE=2 SV=2
8	AFDB:Q01978	0.235	0.237	1.506E-43	658	0.532	0.540	Q01978.pdb.gz	TFE2_XENLA Transcription factor E2-alpha OS=Xenopus laevis OX=8355 GN=tcf3 PE=1 SV=1
9	AFDB:P15923	0.250	0.254	1.273E-42	654	0.528	0.538	P15923.pdb.gz	TFE2_HUMAN Transcription factor E2-alpha OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=1
10	AFDB:Q56R80	0.161	0.161	8.212E-40	667	0.507	0.507	Q56R80.pdb.gz	Q56R80_ICTPU E2A-1 transcription factor OS=Ictalurus punctatus OX=7998 GN=tcf3b PE=2 SV=1
11	PDB:3ojaA	0.091	0.119	9.883E-1	482	0.022	0.031	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
12	PDB:2bskD	0.059	0.302	1.291	90	0.016	0.122	2bskD.pdb.gz
13	PDB:2bskC	0.061	0.371	2.058	79	0.007	0.063	2bskC.pdb.gz
14	PDB:7cgpJ	0.061	0.344	2.873	83	0.013	0.108	7cgpJ.pdb.gz
15	PDB:5apnh	0.049	0.220	3.752	119	0.016	0.092	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:7z37DP1	0.064	0.136	4.287	273	0.033	0.081	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
17	PDB:7myjC	0.034	0.045	4.583	465	0.028	0.041	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
18	PDB:3ndpB	0.037	0.097	4.899	206	0.010	0.034	3ndpB.pdb.gz
19	PDB:7edxc	0.055	0.166	4.899	127	0.027	0.142	7edxc.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:7msnA	0.050	0.078	5.237	417	0.018	0.029	7msnA.pdb.gz	Structural and mechanistic investigations of protein S-glycosyltransferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4IIL6	0.0	556	655	0.522	0.531	A4IIL6_XENTR Tcf3 protein OS=Xenopus tropicalis OX=8364 GN=tcf3 PE=2 SV=1
2	B4DGI9	0.0	667	666	0.603	0.604	B4DGI9_HUMAN Transcription factor 12 (Fragment) OS=Homo sapiens OX=9606 GN=TCF12 PE=1 SV=1
3	F7BGG6	0.0	675	702	0.619	0.588	F7BGG6_XENTR Transcription factor 12 (HTF4, helix-loop-helix transcription factors 4) OS=Xenopus tropicalis OX=8364 GN=tcf12 PE=4 SV=4
4	P15884	0.0	1354	667	1.000	1.000	ITF2_HUMAN Transcription factor 4 OS=Homo sapiens OX=9606 GN=TCF4 PE=1 SV=3
5	P51514	0.0	720	707	0.646	0.610	HTF4_RAT Transcription factor 12 OS=Rattus norvegicus OX=10116 GN=Tcf12 PE=1 SV=1
6	Q01978	0.0	573	658	0.544	0.552	TFE2_XENLA Transcription factor E2-alpha OS=Xenopus laevis OX=8355 GN=tcf3 PE=1 SV=1
7	Q60722	0.0	1323	670	0.981	0.976	ITF2_MOUSE Transcription factor 4 OS=Mus musculus OX=10090 GN=Tcf4 PE=1 SV=1
8	Q61286	0.0	714	706	0.646	0.610	HTF4_MOUSE Transcription factor 12 OS=Mus musculus OX=10090 GN=Tcf12 PE=1 SV=2
9	Q62655	0.0	1140	589	0.855	0.968	ITF2_RAT Transcription factor 4 OS=Rattus norvegicus OX=10116 GN=Tcf4 PE=1 SV=2
10	Q6QR57	0.0	664	697	0.594	0.568	Q6QR57_ICTPU E-box binding protein 2 OS=Ictalurus punctatus OX=7998 GN=tcf12 PE=2 SV=1
11	Q6QR58	0.0	657	705	0.595	0.563	Q6QR58_ICTPU E-box binding protein 1 OS=Ictalurus punctatus OX=7998 GN=tcf12 PE=2 SV=1
12	Q70IK3	0.0	633	669	0.583	0.581	Q70IK3_CHICK Helix-loop-helix protein E12 OS=Gallus gallus OX=9031 GN=TCF3 PE=2 SV=2
13	Q91YV0	0.0	967	507	0.712	0.937	Q91YV0_MOUSE Tcf4 protein OS=Mus musculus OX=10090 GN=Tcf4 PE=1 SV=1
14	Q99081	0.0	743	682	0.649	0.635	HTF4_HUMAN Transcription factor 12 OS=Homo sapiens OX=9606 GN=TCF12 PE=1 SV=1
15	P98180	8.37e-177	520	649	0.520	0.535	TFE2_MESAU Transcription factor E2-alpha OS=Mesocricetus auratus OX=10036 GN=TCF3 PE=2 SV=1
16	P15923	3.28e-175	516	654	0.531	0.541	TFE2_HUMAN Transcription factor E2-alpha OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=1
17	P21677	2.29e-174	513	649	0.511	0.525	TFE2_RAT Transcription factor E2-alpha OS=Rattus norvegicus OX=10116 GN=Tcf3 PE=1 SV=1
18	Q56R80	1.37e-173	512	667	0.522	0.522	Q56R80_ICTPU E2A-1 transcription factor OS=Ictalurus punctatus OX=7998 GN=tcf3b PE=2 SV=1
19	P15806	3.17e-173	511	651	0.510	0.522	TFE2_MOUSE Transcription factor E2-alpha OS=Mus musculus OX=10090 GN=Tcf3 PE=1 SV=2
20	X6REB3	6.30e-165	490	679	0.513	0.504	X6REB3_HUMAN Transcription factor 3 OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	2.2e-08	45.3	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381382

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.999	Catenin beta-1
2	9606.ENSP00000365280	0.992	DNA-binding protein inhibitor ID-1
3	9606.ENSP00000234091	0.989	DNA-binding protein inhibitor ID-2
4	9606.ENSP00000388940	0.977	Transcription factor 12
5	9606.ENSP00000294339	0.974	T-cell acute lymphocytic leukemia protein 1
6	9606.ENSP00000365682	0.943	Transducin-like enhancer protein 1
7	9606.ENSP00000405574	0.939	F-box-like/WD repeat-containing protein TBL1XR1
8	9606.ENSP00000266744	0.938	Achaete-scute homolog 1
9	9606.ENSP00000452871	0.936	Transducin-like enhancer protein 3
10	9606.ENSP00000241651	0.932	Myogenin
11	9606.ENSP00000250003	0.932	Myoblast determination protein 1
12	9606.ENSP00000295108	0.930	Neurogenic differentiation factor 1
13	9606.ENSP00000302216	0.930	Protein atonal homolog 1
14	9606.ENSP00000362649	0.930	Histone deacetylase 1
15	9606.ENSP00000335320	0.929	B-cell CLL/lymphoma 9-like protein
16	9606.ENSP00000234739	0.925	B-cell CLL/lymphoma 9 protein
17	9606.ENSP00000392466	0.925	LIM domain-binding protein 1
18	9606.ENSP00000365720	0.919	Transducin-like enhancer protein 4
19	9606.ENSP00000377508	0.915	Junction plakoglobin
20	9606.ENSP00000363689	0.912	DNA-binding protein inhibitor ID-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	0.999	transcription factor binding
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700	0.998	DNA-binding transcription factor activity
GO:0000981	0.976	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0070888	0.965	E-box binding
GO:0001228	0.861	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0140297	0.858	DNA-binding transcription factor binding
GO:0046983	0.730	protein dimerization activity
GO:0046982	0.718	protein heterodimerization activity
GO:0003682	0.471	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.996	regulation of primary metabolic process
GO:0010468	0.996	regulation of gene expression
GO:0010604	0.996	positive regulation of macromolecule metabolic process
GO:0009889	0.995	regulation of biosynthetic process
GO:0051173	0.995	positive regulation of nitrogen compound metabolic process
GO:0031325	0.995	positive regulation of cellular metabolic process
GO:0045893	0.991	positive regulation of DNA-templated transcription
GO:0006357	0.873	regulation of transcription by RNA polymerase II
GO:0045944	0.825	positive regulation of transcription by RNA polymerase II
GO:0009987	0.307	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.995	protein-containing complex
GO:0005667	0.993	transcription regulator complex
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0005694	0.734	chromosome
GO:0005737	0.437	cytoplasm
GO:0000785	0.399	chromatin
GO:0140513	0.365	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]