StarFunc result for job id P15907

User Input

>input (406 residues)
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDS
QSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMN
KYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGP
WGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTE
KRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQM
PWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFF
DSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15907	1.000	1.000	2.875E-86	406	1.000	1.000	P15907.pdb.gz	SIAT1_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GAL1 PE=1 SV=1
2	AFDB:P13721	0.835	0.840	8.584E-74	403	0.805	0.811	P13721.pdb.gz	SIAT1_RAT Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St6gal1 PE=1 SV=2
3	AFDB:Q96JF0	0.742	0.572	2.249E-46	529	0.387	0.297	Q96JF0.pdb.gz	SIAT2_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GAL2 PE=1 SV=2
4	AFDB:Q76K27	0.741	0.577	2.313E-44	524	0.377	0.292	Q76K27.pdb.gz	SIAT2_MOUSE Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St6gal2 PE=2 SV=2
5	AFDB:Q9GU23	0.645	0.555	5.546E-30	474	0.305	0.262	Q9GU23.pdb.gz	Q9GU23_DROME Beta-galactoside alpha-2,6-sialyltransferase OS=Drosophila melanogaster OX=7227 GN=SiaT PE=2 SV=1
6	AFDB:Q9BVH7	0.425	0.504	8.726E-13	336	0.177	0.214	Q9BVH7.pdb.gz	SIA7E_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Homo sapiens OX=9606 GN=ST6GALNAC5 PE=1 SV=1
7	AFDB:O43173	0.454	0.481	9.282E-13	380	0.192	0.205	O43173.pdb.gz	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
8	AFDB:B0CN48	0.450	0.483	1.948E-12	374	0.187	0.203	B0CN48.pdb.gz	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
9	AFDB:Q9H4F1	0.408	0.538	4.920E-12	302	0.128	0.172	Q9H4F1.pdb.gz	SIA7D_HUMAN Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase OS=Homo sapiens OX=9606 GN=ST6GALNAC4 PE=2 SV=2
10	AFDB:Q1LVN2	0.410	0.433	8.065E-12	381	0.177	0.189	Q1LVN2.pdb.gz
11	PDB:6aplC	0.344	0.446	8.305E-9	306	0.163	0.216	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:2zpaB	0.135	0.092	2.581E-2	662	0.044	0.027	2zpaB.pdb.gz	RNA helicase module in an acetyltransferase that modifies a specific tRNA anticodon
13	PDB:7z6hK	0.126	0.118	2.920E-2	439	0.084	0.077	7z6hK.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
14	PDB:5ylzW	0.151	0.095	3.304E-2	703	0.067	0.038	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
15	PDB:7pzyB	0.146	0.233	3.739E-2	208	0.074	0.144	7pzyB.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
16	PDB:6ff7q	0.151	0.108	5.416E-2	625	0.047	0.030	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:5xjcY	0.126	0.082	6.934E-2	713	0.064	0.036	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
18	PDB:5uf8A	0.129	0.239	7.376E-2	161	0.044	0.112	5uf8A.pdb.gz	Crystal structure of the ARF family small GTPase ARF2 from Candida albicans in complex with GDP
19	PDB:5wsge	0.151	0.102	8.346E-2	679	0.062	0.037	5wsge.pdb.gz	Structure of a yeast step II catalytically activated spliceosome
20	PDB:2b6hA	0.131	0.256	8.878E-2	171	0.032	0.076	2b6hA.pdb.gz	Structure of human ADP-ribosylation factor 5

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13721	0.0	687	403	0.805	0.811	SIAT1_RAT Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St6gal1 PE=1 SV=2
2	P15907	0.0	850	406	1.000	1.000	SIAT1_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GAL1 PE=1 SV=1
3	Q64685	0.0	684	403	0.796	0.801	SIAT1_MOUSE Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St6gal1 PE=1 SV=2
4	Q96JF0	1.18e-108	331	529	0.382	0.293	SIAT2_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GAL2 PE=1 SV=2
5	Q76K27	1.86e-100	310	524	0.369	0.286	SIAT2_MOUSE Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St6gal2 PE=2 SV=2
6	Q9W121	3.32e-59	201	451	0.266	0.239	Q9W121_DROME Sialyltransferase OS=Drosophila melanogaster OX=7227 GN=SiaT PE=2 SV=1
7	Q9GU23	4.40e-59	201	474	0.266	0.228	Q9GU23_DROME Beta-galactoside alpha-2,6-sialyltransferase OS=Drosophila melanogaster OX=7227 GN=SiaT PE=2 SV=1
8	Q9BVH7	2.87e-14	75.5	336	0.135	0.164	SIA7E_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Homo sapiens OX=9606 GN=ST6GALNAC5 PE=1 SV=1
9	Q9QYJ1	5.24e-14	74.7	336	0.148	0.179	SIA7E_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Mus musculus OX=10090 GN=St6galnac5 PE=1 SV=1
10	Q16842	3.00e-13	72.8	350	0.126	0.146	SIA4B_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=1 SV=1
11	Q969X2	4.25e-13	72.0	333	0.138	0.168	SIA7F_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Homo sapiens OX=9606 GN=ST6GALNAC6 PE=1 SV=1
12	Q11204	6.86e-13	71.6	350	0.123	0.143	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
13	Q11205	9.90e-13	71.2	350	0.123	0.143	SIA4B_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Rattus norvegicus OX=10116 GN=St3gal2 PE=1 SV=1
14	Q91Y74	1.56e-12	70.5	333	0.175	0.213	SIA4C_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Mus musculus OX=10090 GN=St3gal4 PE=1 SV=1
15	Q08BF4	2.03e-12	70.5	382	0.118	0.126	Q08BF4_DANRE ST3 beta-galactoside alpha-2,3-sialyltransferase 5, like OS=Danio rerio OX=7955 GN=zgc:153853 PE=2 SV=1
16	Q9JM95	2.72e-12	69.7	333	0.121	0.147	SIA7F_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Mus musculus OX=10090 GN=St6galnac6 PE=1 SV=1
17	P61131	8.04e-12	68.2	333	0.172	0.210	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
18	O43173	8.65e-12	68.6	380	0.140	0.150	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
19	B0CN48	1.78e-11	67.4	374	0.133	0.144	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
20	Q64689	2.68e-11	67.0	380	0.135	0.145	SIA8C_MOUSE Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	7.4e-32	122.5	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000169298

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369055	0.971	Beta-1,4-galactosyltransferase 1
2	9606.ENSP00000310696	0.948	Beta-1,4-galactosyltransferase 2
3	9606.ENSP00000480428	0.938	Beta-1,4-galactosyltransferase 3
4	9606.ENSP00000262915	0.936	ST3 beta-galactoside alpha-2,3-sialyltransferase 3
5	9606.ENSP00000366549	0.926	Lactosylceramide alpha-2,3-sialyltransferase
6	9606.ENSP00000420161	0.925	Beta-1,4-galactosyltransferase 4
7	9606.ENSP00000484824	0.924	Mucin-1
8	9606.ENSP00000381008	0.919	Mucin-16
9	9606.ENSP00000485659	0.916	Mucin-5AC
10	9606.ENSP00000306459	0.915	Beta-1,4-galactosyltransferase 6
11	9606.ENSP00000417498	0.910	Mucin-4
12	9606.ENSP00000406861	0.906	Mucin-6
13	9606.ENSP00000414350	0.906	Mucin-20
14	9606.ENSP00000436812	0.904	Mucin-5B
15	9606.ENSP00000441929	0.904	Mucin-12
16	9606.ENSP00000407422	0.903	Mucin-7
17	9606.ENSP00000485028	0.902	Mucin-13
18	9606.ENSP00000302716	0.900	Mucin-17
19	9606.ENSP00000311364	0.900	Mucin-like protein 1
20	9606.ENSP00000365473	0.900	Mucin-21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0005515	0.982	protein binding
GO:0042802	0.395	identical protein binding
GO:0046983	0.357	protein dimerization activity
GO:0042803	0.327	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0043170	0.990	macromolecule metabolic process
GO:0044237	0.989	cellular metabolic process
GO:1901564	0.988	organonitrogen compound metabolic process
GO:1901135	0.976	carbohydrate derivative metabolic process
GO:0006486	0.962	protein glycosylation
GO:0006487	0.407	protein N-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.998	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.

[back to server]