StarFunc result for job id P15923

User Input

>input (654 residues)
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWG
SGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGL
TQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGL
PSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPML
GGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGAT
YGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSP
QGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLP
GHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPD
SYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPP
EQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVIL
NLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15923	1.000	1.000	1.561E-90	654	1.000	1.000	P15923.pdb.gz	TFE2_HUMAN Transcription factor E2-alpha OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=1
2	AFDB:X6REB3	0.157	0.152	1.453E-79	679	0.963	0.928	X6REB3.pdb.gz	X6REB3_HUMAN Transcription factor 3 OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=2
3	AFDB:P15806	0.282	0.283	2.639E-74	651	0.830	0.834	P15806.pdb.gz	TFE2_MOUSE Transcription factor E2-alpha OS=Mus musculus OX=10090 GN=Tcf3 PE=1 SV=2
4	AFDB:Q70IK3	0.173	0.169	1.430E-60	669	0.732	0.716	Q70IK3.pdb.gz	Q70IK3_CHICK Helix-loop-helix protein E12 OS=Gallus gallus OX=9031 GN=TCF3 PE=2 SV=2
5	AFDB:Q56R80	0.150	0.147	1.054E-44	667	0.561	0.550	Q56R80.pdb.gz	Q56R80_ICTPU E2A-1 transcription factor OS=Ictalurus punctatus OX=7998 GN=tcf3b PE=2 SV=1
6	AFDB:A0A024R5T1	0.161	0.156	1.034E-43	682	0.526	0.504	A0A024R5T1.pdb.gz
7	AFDB:Q60722	0.211	0.207	1.536E-42	670	0.532	0.519	Q60722.pdb.gz	ITF2_MOUSE Transcription factor 4 OS=Mus musculus OX=10090 GN=Tcf4 PE=1 SV=1
8	AFDB:F7BGG6	0.151	0.141	2.810E-41	702	0.526	0.490	F7BGG6.pdb.gz	F7BGG6_XENTR Transcription factor 12 (HTF4, helix-loop-helix transcription factors 4) OS=Xenopus tropicalis OX=8364 GN=tcf12 PE=4 SV=4
9	AFDB:E2J8V4	0.157	0.152	1.877E-38	677	0.497	0.480	E2J8V4.pdb.gz
10	AFDB:Q6QR58	0.187	0.176	4.019E-38	705	0.489	0.454	Q6QR58.pdb.gz	Q6QR58_ICTPU E-box binding protein 1 OS=Ictalurus punctatus OX=7998 GN=tcf12 PE=2 SV=1
11	PDB:3ojaA	0.079	0.100	4.731E-1	482	0.026	0.035	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
12	PDB:2bskC	0.061	0.363	8.820E-1	79	0.008	0.063	2bskC.pdb.gz
13	PDB:7cgpJ	0.061	0.345	1.888	83	0.015	0.120	7cgpJ.pdb.gz
14	PDB:7r5sS	0.064	0.232	2.860	120	0.034	0.183	7r5sS.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
15	PDB:7pubCI	0.051	0.070	3.284	427	0.020	0.030	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
16	PDB:5c0wL	0.051	0.212	3.520	113	0.017	0.097	5c0wL.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
17	PDB:3ndpB	0.035	0.096	3.772	206	0.011	0.034	3ndpB.pdb.gz
18	PDB:6tuyA	0.061	0.060	3.772	667	0.020	0.019	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
19	PDB:5apnh	0.048	0.219	4.042	119	0.024	0.134	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
20	PDB:7mq8SB	0.038	0.050	4.042	440	0.011	0.016	7mq8SB.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4IIL6	0.0	704	655	0.599	0.598	A4IIL6_XENTR Tcf3 protein OS=Xenopus tropicalis OX=8364 GN=tcf3 PE=2 SV=1
2	K7ENH8	0.0	520	314	0.405	0.844	K7ENH8_HUMAN Transcription factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=2
3	P15806	0.0	1048	651	0.830	0.834	TFE2_MOUSE Transcription factor E2-alpha OS=Mus musculus OX=10090 GN=Tcf3 PE=1 SV=2
4	P15923	0.0	1298	654	1.000	1.000	TFE2_HUMAN Transcription factor E2-alpha OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=1
5	P21677	0.0	1041	649	0.821	0.827	TFE2_RAT Transcription factor E2-alpha OS=Rattus norvegicus OX=10116 GN=Tcf3 PE=1 SV=1
6	P51514	0.0	533	707	0.544	0.504	HTF4_RAT Transcription factor 12 OS=Rattus norvegicus OX=10116 GN=Tcf12 PE=1 SV=1
7	P98180	0.0	1047	649	0.832	0.838	TFE2_MESAU Transcription factor E2-alpha OS=Mesocricetus auratus OX=10036 GN=TCF3 PE=2 SV=1
8	Q01978	0.0	734	658	0.636	0.632	TFE2_XENLA Transcription factor E2-alpha OS=Xenopus laevis OX=8355 GN=tcf3 PE=1 SV=1
9	Q56R80	0.0	602	667	0.569	0.558	Q56R80_ICTPU E2A-1 transcription factor OS=Ictalurus punctatus OX=7998 GN=tcf3b PE=2 SV=1
10	Q61286	0.0	536	706	0.543	0.503	HTF4_MOUSE Transcription factor 12 OS=Mus musculus OX=10090 GN=Tcf12 PE=1 SV=2
11	Q70IK3	0.0	875	669	0.731	0.714	Q70IK3_CHICK Helix-loop-helix protein E12 OS=Gallus gallus OX=9031 GN=TCF3 PE=2 SV=2
12	Q99081	0.0	555	682	0.554	0.531	HTF4_HUMAN Transcription factor 12 OS=Homo sapiens OX=9606 GN=TCF12 PE=1 SV=1
13	X6REB3	0.0	1112	679	0.965	0.929	X6REB3_HUMAN Transcription factor 3 OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=2
14	Q60722	2.42e-180	529	670	0.550	0.537	ITF2_MOUSE Transcription factor 4 OS=Mus musculus OX=10090 GN=Tcf4 PE=1 SV=1
15	P15884	2.42e-176	519	667	0.541	0.531	ITF2_HUMAN Transcription factor 4 OS=Homo sapiens OX=9606 GN=TCF4 PE=1 SV=3
16	F7BGG6	3.30e-175	517	702	0.535	0.499	F7BGG6_XENTR Transcription factor 12 (HTF4, helix-loop-helix transcription factors 4) OS=Xenopus tropicalis OX=8364 GN=tcf12 PE=4 SV=4
17	Q6QR57	3.34e-172	509	697	0.524	0.492	Q6QR57_ICTPU E-box binding protein 2 OS=Ictalurus punctatus OX=7998 GN=tcf12 PE=2 SV=1
18	Q6QR58	3.53e-170	504	705	0.523	0.485	Q6QR58_ICTPU E-box binding protein 1 OS=Ictalurus punctatus OX=7998 GN=tcf12 PE=2 SV=1
19	B4DGI9	1.84e-158	473	666	0.509	0.500	B4DGI9_HUMAN Transcription factor 12 (Fragment) OS=Homo sapiens OX=9606 GN=TCF12 PE=1 SV=1
20	Q62655	1.40e-153	457	589	0.460	0.511	ITF2_RAT Transcription factor 4 OS=Rattus norvegicus OX=10116 GN=Tcf4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	1.1e-06	39.8	Helix-loop-helix DNA-binding domain
2	PF19192 Response_reg_2	1.9e+02	13.5	Response receiver domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262965

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000250003	0.999	Myoblast determination protein 1
2	9606.ENSP00000294339	0.999	T-cell acute lymphocytic leukemia protein 1
3	9606.ENSP00000264824	0.996	Protein lyl-1
4	9606.ENSP00000257818	0.995	Rhombotin-2
5	9606.ENSP00000263253	0.995	Histone acetyltransferase p300
6	9606.ENSP00000234091	0.993	DNA-binding protein inhibitor ID-2
7	9606.ENSP00000242261	0.991	Twist-related protein 1
8	9606.ENSP00000365858	0.990	Erythroid transcription factor
9	9606.ENSP00000392466	0.988	LIM domain-binding protein 1
10	9606.ENSP00000365280	0.987	DNA-binding protein inhibitor ID-1
11	9606.ENSP00000344456	0.980	Catenin beta-1
12	9606.ENSP00000363689	0.980	DNA-binding protein inhibitor ID-3
13	9606.ENSP00000241651	0.975	Myogenin
14	9606.ENSP00000295108	0.963	Neurogenic differentiation factor 1
15	9606.ENSP00000338272	0.958	Hairy/enhancer-of-split related with YRPW motif protein 1
16	9606.ENSP00000405890	0.953	Pre-B-cell leukemia transcription factor 1
17	9606.ENSP00000262367	0.950	CREB-binding protein
18	9606.ENSP00000332973	0.943	Mothers against decapentaplegic homolog 3
19	9606.ENSP00000266744	0.942	Achaete-scute homolog 1
20	9606.ENSP00000306772	0.935	LIM domain-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043425	1.000	bHLH transcription factor binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0070888	1.000	E-box binding
GO:0046982	0.975	protein heterodimerization activity
GO:0061629	0.974	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0019899	0.918	enzyme binding
GO:0042802	0.913	identical protein binding
GO:0001227	0.899	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0019900	0.885	kinase binding
GO:0031435	0.859	mitogen-activated protein kinase kinase kinase binding
GO:0042803	0.840	protein homodimerization activity
GO:0070644	0.562	vitamin D response element binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0048522	0.988	positive regulation of cellular process
GO:0006355	0.988	regulation of DNA-templated transcription
GO:0010604	0.976	positive regulation of macromolecule metabolic process
GO:0045893	0.961	positive regulation of DNA-templated transcription
GO:0006357	0.939	regulation of transcription by RNA polymerase II
GO:0045944	0.893	positive regulation of transcription by RNA polymerase II
GO:0009987	0.587	cellular process
GO:0048856	0.368	anatomical structure development
GO:0048519	0.308	negative regulation of biological process
GO:0048523	0.303	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.989	protein-containing complex
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0140513	0.890	nuclear protein-containing complex
GO:0005667	0.870	transcription regulator complex
GO:0005694	0.848	chromosome
GO:0000785	0.695	chromatin
GO:0090575	0.665	RNA polymerase II transcription regulator complex
GO:0005737	0.589	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]