StarFunc result for job id P15924

User Input

>input (1400 residues)
MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTG
TMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEI
LDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGW
DEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKA
DLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD
KNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSW
ILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKE
LEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGD
ECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQL
YINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMF
GDDDKRKIQSQFTDAQKHYQTLVIQLPGYPQHQTVTTTEITHHGTCQDVNHNKVIETNRE
NDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKSVQNDSQAIA
EVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCTVRALLQAILQT
EDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQKAQQIHS
QTSQQYPLYDLDLGKFGEKVTQLTDRWQRIDKQIDFRLWDLEKQIKQLRNYRDNYQAFCK
WLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHSEISGKRDKSEEVQKIAELCANSIKD
YELQLASYTSGLETLLNIPIKRTMIQSPSGVILQEAADVHARYIELLTRSGDYYRFLSEM
LKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQFKAKLASLE
ELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKNDYD
QLQKARQCEKENLGWQKLESEKAIKEKEYEIERLRVLLQEEGTRKREYENELAKVRNHYN
EEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLKDEIVRLNDSI
LQATEQRRRAEENALQQKACGSEIMQKKQHLEIELKQVMQQRSEDNARHKQSLEEAAKTI
QDKNKEIERLKAEFQEEAKRRWEYENELSKVRNNYDEEIISLKNQFETEINITKTTIHQL
TMQKEEDTSGYRAQIDNLTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60437	0.239	0.192	1.852E-33	1756	0.173	0.138	O60437.pdb.gz	PEPL_HUMAN Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4
2	AFDB:Q9R269	0.245	0.197	5.044E-32	1755	0.198	0.158	Q9R269.pdb.gz	PEPL_MOUSE Periplakin OS=Mus musculus OX=10090 GN=Ppl PE=1 SV=1
3	AFDB:Q9D952	0.225	0.159	1.083E-29	2035	0.148	0.102	Q9D952.pdb.gz	EVPL_MOUSE Envoplakin OS=Mus musculus OX=10090 GN=Evpl PE=1 SV=3
4	AFDB:Q92817	0.233	0.162	4.099E-29	2033	0.146	0.101	Q92817.pdb.gz	EVPL_HUMAN Envoplakin OS=Homo sapiens OX=9606 GN=EVPL PE=1 SV=3
5	AFDB:Q21408	0.192	0.116	5.713E-13	2432	0.089	0.051	Q21408.pdb.gz	Q21408_CAEEL Spectrin alpha chain OS=Caenorhabditis elegans OX=6239 GN=spc-1 PE=1 SV=2
6	AFDB:Q503P9	0.158	0.270	2.577E-11	786	0.081	0.145	Q503P9.pdb.gz
7	AFDB:F1QQE5	0.128	0.081	6.352E-9	2357	0.087	0.052	F1QQE5.pdb.gz	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
8	AFDB:Q01082	0.123	0.077	2.193E-8	2364	0.086	0.051	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
9	AFDB:P11277	0.137	0.096	3.024E-8	2137	0.094	0.061	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
10	AFDB:E0AHA7	0.177	0.112	9.525E-8	2326	0.089	0.054	E0AHA7.pdb.gz	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
11	PDB:1tr2B	0.062	0.074	3.872E-3	1029	0.084	0.114	1tr2B.pdb.gz
12	PDB:7ktuA	0.076	0.096	7.031E-3	995	0.086	0.122	7ktuA.pdb.gz
13	PDB:6nr7A	0.066	0.081	1.534E-2	1086	0.093	0.120	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
14	PDB:7z8fe	0.090	0.041	3.841E-2	4579	0.075	0.023	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
15	PDB:3ehqA	0.040	0.274	6.363E-2	182	0.011	0.082	3ehqA.pdb.gz
16	PDB:6fuyA	0.061	0.082	8.381E-2	961	0.065	0.095	6fuyA.pdb.gz
17	PDB:7ajuUT	0.055	0.041	1.007E-1	2313	0.077	0.047	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:6yvuB	0.054	0.061	1.104E-1	1191	0.087	0.102	6yvuB.pdb.gz
19	PDB:6bfiB	0.064	0.099	1.156E-1	806	0.067	0.117	6bfiB.pdb.gz
20	PDB:6r9tA	0.057	0.044	1.454E-1	2185	0.081	0.052	6r9tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q557	0.0	2740	2883	0.951	0.462	DESP_MOUSE Desmoplakin OS=Mus musculus OX=10090 GN=Dsp PE=1 SV=1
2	F1LMV6	0.0	2744	2877	0.952	0.463	DESP_RAT Desmoplakin OS=Rattus norvegicus OX=10116 GN=Dsp PE=1 SV=1
3	P15924	0.0	2917	2871	1.000	0.488	DESP_HUMAN Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3
4	Q9QXS1	8.00e-164	550	4691	0.264	0.079	PLEC_MOUSE Plectin OS=Mus musculus OX=10090 GN=Plec PE=1 SV=3
5	P30427	8.00e-163	546	4687	0.254	0.076	PLEC_RAT Plectin OS=Rattus norvegicus OX=10116 GN=Plec PE=1 SV=2
6	Q15149	5.92e-162	544	4684	0.243	0.073	PLEC_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3
7	Q9JI55	6.74e-161	541	4473	0.256	0.080	PLEC_CRIGR Plectin (Fragment) OS=Cricetulus griseus OX=10029 GN=PLEC PE=1 SV=1
8	A5WV02	2.33e-156	527	4577	0.206	0.063	A5WV02_DANRE Plectin OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
9	A0A2R8RIJ1	3.04e-156	527	4599	0.206	0.063	A0A2R8RIJ1_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
10	H0YDN1	3.04e-156	527	3447	0.206	0.084	H0YDN1_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=9
11	E7F8G7	3.13e-156	527	4762	0.206	0.060	E7F8G7_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
12	A0A2R8PVX9	3.36e-156	527	4580	0.206	0.063	A0A2R8PVX9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
13	A0A286YBE9	5.29e-156	526	4773	0.206	0.061	A0A286YBE9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
14	A0A0R4IJ71	8.57e-156	526	4506	0.262	0.081	A0A0R4IJ71_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=2
15	E9QCV2	1.02e-155	525	4530	0.262	0.081	E9QCV2_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=1
16	F8W9J4	3.04e-155	524	7461	0.205	0.038	F8W9J4_HUMAN Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=1
17	Q03001	3.67e-155	524	7570	0.205	0.038	DYST_HUMAN Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=4
18	Q91ZU6	3.03e-151	512	7393	0.201	0.038	DYST_MOUSE Dystonin OS=Mus musculus OX=10090 GN=Dst PE=1 SV=2
19	D3ZHV2	9.67e-140	478	5430	0.197	0.051	MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus OX=10116 GN=Macf1 PE=1 SV=1
20	Q9QXZ0	5.59e-139	476	7354	0.195	0.037	MACF1_MOUSE Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4 OS=Mus musculus OX=10090 GN=Macf1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17902 SH3_10	1.8e-15	68.0	SH3 domain
2	PF00435 Spectrin	31	16.5	Spectrin repeat
3	PF18373 Spectrin_like	5.8e-28	108.2	Spectrin like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000030221

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000050160	0.961	Uncharacterized protein
2	9598.ENSPTRP00000015634	0.950	Junction plakoglobin
3	9598.ENSPTRP00000045442	0.912	Uncharacterized protein
4	9598.ENSPTRP00000016915	0.911	Uncharacterized protein
5	9598.ENSPTRP00000003063	0.899	Uncharacterized protein
6	9598.ENSPTRP00000021468	0.898	Plakophilin 4
7	9598.ENSPTRP00000016913	0.890	Uncharacterized protein
8	9598.ENSPTRP00000016907	0.867	Uncharacterized protein
9	9598.ENSPTRP00000016911	0.856	Uncharacterized protein
10	9598.ENSPTRP00000049431	0.851	Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion
11	9598.ENSPTRP00000042390	0.840	Uncharacterized protein
12	9598.ENSPTRP00000031829	0.772	Uncharacterized protein
13	9598.ENSPTRP00000013985	0.749	Uncharacterized protein
14	9598.ENSPTRP00000028705	0.741	Catenin (cadherin-associated protein), delta 2
15	9598.ENSPTRP00000034930	0.728	Uncharacterized protein
16	9598.ENSPTRP00000016404	0.719	Integrin, beta 4
17	9598.ENSPTRP00000016903	0.705	Cadherin 2, type 1, N-cadherin (Neuronal)
18	9598.ENSPTRP00000032380	0.694	Uncharacterized protein
19	9598.ENSPTRP00000054330	0.694	Caspase-3
20	9598.ENSPTRP00000014119	0.686	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.309	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.961	cellular process
GO:0032502	0.960	developmental process
GO:0048856	0.918	anatomical structure development
GO:0043588	0.853	skin development
GO:0050789	0.822	regulation of biological process
GO:0050896	0.815	response to stimulus
GO:0042060	0.781	wound healing
GO:0050794	0.743	regulation of cellular process
GO:0018149	0.554	peptide cross-linking
GO:1903115	0.516	regulation of actin filament-based movement
GO:0071840	0.491	cellular component organization or biogenesis
GO:0008016	0.479	regulation of heart contraction
GO:0009888	0.469	tissue development
GO:0061337	0.468	cardiac conduction
GO:0016043	0.460	cellular component organization
GO:0065008	0.442	regulation of biological quality
GO:0032501	0.426	multicellular organismal process
GO:0098609	0.371	cell-cell adhesion
GO:0045216	0.364	cell-cell junction organization
GO:0007275	0.348	multicellular organism development
GO:0008544	0.330	epidermis development
GO:0034332	0.314	adherens junction organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0043229	0.997	intracellular organelle
GO:0014704	0.997	intercalated disc
GO:0005886	0.993	plasma membrane
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0005737	0.956	cytoplasm
GO:0043232	0.956	intracellular non-membrane-bounded organelle
GO:0005576	0.850	extracellular region
GO:0012505	0.848	endomembrane system
GO:0005634	0.832	nucleus
GO:0030057	0.810	desmosome
GO:0031982	0.744	vesicle
GO:0005856	0.722	cytoskeleton
GO:0031090	0.535	organelle membrane
GO:0001533	0.469	cornified envelope
GO:0099512	0.413	supramolecular fiber
GO:0065010	0.402	extracellular membrane-bounded organelle
GO:0099513	0.397	polymeric cytoskeletal fiber
GO:0070062	0.387	extracellular exosome
GO:0005654	0.359	nucleoplasm
GO:0098590	0.358	plasma membrane region
GO:0097708	0.355	intracellular vesicle
GO:0031410	0.346	cytoplasmic vesicle
GO:0045111	0.342	intermediate filament cytoskeleton
GO:0005912	0.338	adherens junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]