StarFunc result for job id P15941

User Input

>input (1255 residues)
MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSV
LSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTS
APDNKPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTS
ASGSASGSASTLVHNGTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHS
SVPPLTSSNHSTSPQLSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQI
YKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVS
VSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPAR
DTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15941	1.000	1.000	0.000	1255	1.000	1.000	P15941.pdb.gz	MUC1_HUMAN Mucin-1 OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=3
2	AFDB:Q02496	0.095	0.179	1.697E-20	630	0.159	0.317	Q02496.pdb.gz	MUC1_MOUSE Mucin-1 OS=Mus musculus OX=10090 GN=Muc1 PE=1 SV=2
3	AFDB:A0A0A0MRB3	0.076	0.336	6.824E-16	241	0.148	0.772	A0A0A0MRB3.pdb.gz	A0A0A0MRB3_HUMAN Mucin 1, cell surface associated OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=1
4	AFDB:Q8R1W8	0.082	0.127	2.507E-5	798	0.050	0.079	Q8R1W8.pdb.gz	IMPG1_MOUSE Interphotoreceptor matrix proteoglycan 1 OS=Mus musculus OX=10090 GN=Impg1 PE=1 SV=1
5	AFDB:B1PLB1	0.062	0.161	6.369E-3	386	0.046	0.150	B1PLB1.pdb.gz	B1PLB1_RAT CD34 molecule OS=Rattus norvegicus OX=10116 GN=Cd34 PE=1 SV=1
6	AFDB:E9Q7X6	0.067	0.064	6.678E-3	1337	0.056	0.052	E9Q7X6.pdb.gz	HEG1_MOUSE Protein HEG homolog 1 OS=Mus musculus OX=10090 GN=Heg1 PE=1 SV=1
7	AFDB:Q90Y57	0.066	0.066	1.022E-2	1242	0.021	0.021	Q90Y57.pdb.gz	JAG1A_DANRE Protein jagged-1a OS=Danio rerio OX=7955 GN=jag1a PE=2 SV=1
8	AFDB:Q64314	0.055	0.126	1.983E-2	382	0.048	0.157	Q64314.pdb.gz	CD34_MOUSE Hematopoietic progenitor cell antigen CD34 OS=Mus musculus OX=10090 GN=Cd34 PE=1 SV=1
9	PDB:3n5fA	0.063	0.160	2.152E-2	406	0.013	0.039	3n5fA.pdb.gz	Mutational and structural analysis of L-N-carbamoylase reveals new insights into a peptidase m20/m25/m40 family member.
10	PDB:3kg0B	0.065	0.534	2.601E-2	98	0.008	0.102	3kg0B.pdb.gz
11	PDB:7v61B	0.056	0.084	2.601E-2	751	0.018	0.031	7v61B.pdb.gz
12	AFDB:A0A0R4IAF3	0.058	0.058	2.762E-2	1254	0.025	0.025	A0A0R4IAF3.pdb.gz
13	PDB:3dljA	0.058	0.132	3.622E-2	471	0.020	0.053	3dljA.pdb.gz	Crystal structure of human carnosine dipeptidase 1.
14	PDB:4pxbA	0.061	0.151	3.622E-2	423	0.010	0.031	4pxbA.pdb.gz	Structural insights into the substrate specificity of (s)-ureidoglycolate amidohydrolase and its comparison with allantoate amidohydrolase.
15	AFDB:A0A2R8QT22	0.058	0.060	3.670E-2	1216	0.026	0.027	A0A2R8QT22.pdb.gz
16	PDB:4pxdA	0.063	0.164	3.982E-2	411	0.010	0.029	4pxdA.pdb.gz	Structural insights into the substrate specificity of (s)-ureidoglycolate amidohydrolase and its comparison with allantoate amidohydrolase.
17	PDB:1tuvA	0.062	0.516	4.175E-2	103	0.005	0.058	1tuvA.pdb.gz	Structural and Biochemical Evidence for an Enzymatic Quinone Redox Cycle in Escherichia coli: IDENTIFICATION OF A NOVEL QUINOL MONOOXYGENASE
18	PDB:4er8A	0.064	0.367	6.392E-2	165	0.010	0.079	4er8A.pdb.gz	The processing of repetitive extragenic palindromes: the structure of a repetitive extragenic palindrome bound to its associated nuclease.
19	PDB:2xmaE	0.058	0.351	6.702E-2	141	0.014	0.121	2xmaE.pdb.gz	DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
20	PDB:2zofA	0.057	0.130	7.724E-2	478	0.016	0.042	2zofA.pdb.gz	Structural basis for substrate recognition and hydrolysis by mouse carnosinase CN2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGW3	0.0	720	475	0.303	0.800	A0A0C4DGW3_HUMAN Mucin 1, cell surface associated OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=1
2	P15941	0.0	2268	1255	1.000	1.000	MUC1_HUMAN Mucin-1 OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=3
3	Q02496	6.06e-138	436	630	0.245	0.489	MUC1_MOUSE Mucin-1 OS=Mus musculus OX=10090 GN=Muc1 PE=1 SV=2
4	A0A0A0MRB3	2.42e-130	401	241	0.143	0.743	A0A0A0MRB3_HUMAN Mucin 1, cell surface associated OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=1
5	B1AVQ7	1.18e-127	393	229	0.140	0.769	B1AVQ7_HUMAN Mucin 1, cell surface associated OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=1
6	B2GV31	1.12e-121	394	655	0.232	0.444	B2GV31_RAT Muc1 protein OS=Rattus norvegicus OX=10116 GN=Muc1 PE=2 SV=1
7	A0A087X0L2	5.20e-113	355	239	0.127	0.669	A0A087X0L2_HUMAN Mucin 1, cell surface associated OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=1
8	A0A8I6GM17	6.14e-91	310	656	0.214	0.410	A0A8I6GM17_RAT Mucin 1, cell surface associated OS=Rattus norvegicus OX=10116 GN=Muc1 PE=4 SV=1
9	A6ZIE3	1.91e-61	211	213	0.089	0.526	A6ZIE3_HUMAN MUC1 isoform M9 OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=1
10	A6ZIE4	3.05e-57	198	189	0.084	0.556	A6ZIE4_HUMAN MUC1 isoform M10 OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=1
11	A0A384NPK6	2.25e-47	168	159	0.059	0.465	A0A384NPK6_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
12	O35770	1.36e-39	143	74	0.050	0.851	O35770_RAT Mucin 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc1 PE=2 SV=1
13	Q8IR52	9.68e-36	151	3321	0.278	0.105	Q8IR52_DROME Mucin 12Ea OS=Drosophila melanogaster OX=7227 GN=Muc12Ea PE=4 SV=3
14	Q383G9	6.26e-17	89.4	1464	0.273	0.234	Q383G9_TRYB2 Spt5 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2885 PE=4 SV=1
15	Q9UBC9	7.45e-05	47.0	169	0.036	0.266	SPRR3_HUMAN Small proline-rich protein 3 OS=Homo sapiens OX=9606 GN=SPRR3 PE=1 SV=2
16	Q8WXI7	0.002	45.4	14507	0.032	0.003	MUC16_HUMAN Mucin-16 OS=Homo sapiens OX=9606 GN=MUC16 PE=1 SV=3
17	Q17R60	0.27	38.1	797	0.019	0.030	IMPG1_HUMAN Interphotoreceptor matrix proteoglycan 1 OS=Homo sapiens OX=9606 GN=IMPG1 PE=1 SV=2
18	Q9NAX4	5.3	33.5	464	0.029	0.078	SP65_DICDI Spore coat protein SP65 OS=Dictyostelium discoideum OX=44689 GN=cotE PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01390 SEA	1.3e-08	46.4	SEA domain
2	PF17410 Stevor	7.5e+02	11.0	Subtelomeric Variable Open Reading frame

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000014308

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010419	0.966	Receptor protein-tyrosine kinase
2	61853.ENSNLEP00000006991	0.965	Catenin beta 1
3	61853.ENSNLEP00000010764	0.866	Mucin 6, oligomeric mucus/gel-forming
4	61853.ENSNLEP00000009441	0.865	Uncharacterized protein
5	61853.ENSNLEP00000010793	0.864	annotation not available
6	61853.ENSNLEP00000015544	0.856	Galectin
7	61853.ENSNLEP00000001285	0.846	Receptor protein-tyrosine kinase
8	61853.ENSNLEP00000007631	0.816	Tyrosine-protein kinase
9	61853.ENSNLEP00000021677	0.800	Mucin 15, cell surface associated
10	61853.ENSNLEP00000009352	0.794	Uncharacterized protein
11	61853.ENSNLEP00000009960	0.787	Uncharacterized protein
12	61853.ENSNLEP00000000830	0.774	Mucin 13, cell surface associated
13	61853.ENSNLEP00000010211	0.756	Uncharacterized protein
14	61853.ENSNLEP00000001324	0.750	Polypeptide N-acetylgalactosaminyltransferase 15
15	61853.ENSNLEP00000008101	0.736	Polypeptide N-acetylgalactosaminyltransferase 7
16	61853.ENSNLEP00000020674	0.735	Polypeptide N-acetylgalactosaminyltransferase 12
17	61853.ENSNLEP00000001019	0.721	Growth factor receptor-bound protein 2
18	61853.ENSNLEP00000006895	0.720	Uncharacterized protein
19	61853.ENSNLEP00000018707	0.720	Estrogen receptor
20	61853.ENSNLEP00000015614	0.717	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003712	1.000	transcription coregulator activity
GO:0002039	1.000	p53 binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.965	biological regulation
GO:0050794	0.964	regulation of cellular process
GO:0048519	0.961	negative regulation of biological process
GO:0048523	0.947	negative regulation of cellular process
GO:0030155	0.922	regulation of cell adhesion
GO:0009987	0.702	cellular process
GO:0050896	0.539	response to stimulus
GO:0048518	0.466	positive regulation of biological process
GO:0019222	0.452	regulation of metabolic process
GO:0060255	0.437	regulation of macromolecule metabolic process
GO:0010468	0.429	regulation of gene expression
GO:0031323	0.421	regulation of cellular metabolic process
GO:0048583	0.419	regulation of response to stimulus
GO:0048522	0.417	positive regulation of cellular process
GO:0080090	0.415	regulation of primary metabolic process
GO:0051171	0.415	regulation of nitrogen compound metabolic process
GO:0010604	0.414	positive regulation of macromolecule metabolic process
GO:0009966	0.414	regulation of signal transduction
GO:0007165	0.414	signal transduction
GO:0051173	0.410	positive regulation of nitrogen compound metabolic process
GO:0031326	0.407	regulation of cellular biosynthetic process
GO:0051246	0.406	regulation of protein metabolic process
GO:0010556	0.400	regulation of macromolecule biosynthetic process
GO:0019219	0.400	regulation of nucleobase-containing compound metabolic process
GO:0006950	0.385	response to stress
GO:0006355	0.385	regulation of DNA-templated transcription
GO:0009892	0.382	negative regulation of metabolic process
GO:0031325	0.365	positive regulation of cellular metabolic process
GO:0042981	0.349	regulation of apoptotic process
GO:1903047	0.346	mitotic cell cycle process
GO:0010564	0.346	regulation of cell cycle process
GO:0031401	0.346	positive regulation of protein modification process
GO:1902531	0.345	regulation of intracellular signal transduction
GO:0006974	0.343	cellular response to DNA damage stimulus
GO:1901990	0.343	regulation of mitotic cell cycle phase transition
GO:0043069	0.343	negative regulation of programmed cell death
GO:0035556	0.342	intracellular signal transduction
GO:0045930	0.341	negative regulation of mitotic cell cycle
GO:1902532	0.341	negative regulation of intracellular signal transduction
GO:1901988	0.340	negative regulation of cell cycle phase transition
GO:2001020	0.339	regulation of response to DNA damage stimulus
GO:0043066	0.316	negative regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.998	intracellular anatomical structure
GO:0005886	0.996	plasma membrane
GO:0012505	0.994	endomembrane system
GO:0005737	0.994	cytoplasm
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0070013	0.977	intracellular organelle lumen
GO:0043232	0.940	intracellular non-membrane-bounded organelle
GO:0005576	0.900	extracellular region
GO:0005794	0.697	Golgi apparatus
GO:0031982	0.695	vesicle
GO:0005615	0.678	extracellular space
GO:0043230	0.649	extracellular organelle
GO:1903561	0.535	extracellular vesicle
GO:0070062	0.533	extracellular exosome
GO:0005796	0.385	Golgi lumen
GO:0005694	0.365	chromosome
GO:0000785	0.351	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]