StarFunc result for job id P15976

User Input

>input (413 residues)
MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAAL
AYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQA
VEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPL
NSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP
LIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD
GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGT
AHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15976	1.000	1.000	3.676E-68	413	1.000	1.000	P15976.pdb.gz	GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens OX=9606 GN=GATA1 PE=1 SV=1
2	AFDB:P17679	0.327	0.327	9.793E-59	413	0.860	0.860	P17679.pdb.gz	GATA1_MOUSE Erythroid transcription factor OS=Mus musculus OX=10090 GN=Gata1 PE=1 SV=1
3	AFDB:P91623	0.295	0.253	1.465E-24	486	0.378	0.321	P91623.pdb.gz	GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster OX=7227 GN=grn PE=2 SV=1
4	AFDB:Q5A201	0.089	0.054	1.594E-4	712	0.148	0.086	Q5A201.pdb.gz	GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GZF3 PE=2 SV=2
5	AFDB:E7F0B3	0.062	0.036	3.052E-2	1051	0.169	0.067	E7F0B3.pdb.gz	E7F0B3_DANRE sn-1-specific diacylglycerol lipase OS=Danio rerio OX=7955 GN=dagla PE=4 SV=3
6	AFDB:Q8BLK9	0.078	0.039	7.936E-2	1056	0.169	0.066	Q8BLK9.pdb.gz	KS6C1_MOUSE Ribosomal protein S6 kinase delta-1 OS=Mus musculus OX=10090 GN=Rps6kc1 PE=1 SV=2
7	PDB:5dkaA	0.082	0.300	8.160E-2	96	0.041	0.177	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
8	AFDB:Q9SZW3	0.081	0.036	3.107E-1	1311	0.172	0.054	Q9SZW3.pdb.gz	Q9SZW3_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g30100 PE=1 SV=1
9	AFDB:Q76KF0	0.075	0.034	4.680E-1	1073	0.211	0.081	Q76KF0.pdb.gz	SEM6D_MOUSE Semaphorin-6D OS=Mus musculus OX=10090 GN=Sema6d PE=1 SV=1
10	PDB:1b8tA	0.067	0.132	6.322E-1	192	0.053	0.115	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
11	PDB:4kfzB	0.081	0.203	6.769E-1	148	0.041	0.115	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	AFDB:Q14721	0.073	0.042	7.048E-1	858	0.155	0.075	Q14721.pdb.gz	KCNB1_HUMAN Potassium voltage-gated channel subfamily B member 1 OS=Homo sapiens OX=9606 GN=KCNB1 PE=1 SV=2
13	AFDB:P37304	0.072	0.041	7.546E-1	830	0.177	0.088	P37304.pdb.gz	PAM1_YEAST Protein PAM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAM1 PE=1 SV=2
14	PDB:1imlA	0.076	0.308	1.019	76	0.027	0.145	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
15	PDB:5a31B	0.077	0.310	1.019	84	0.027	0.131	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
16	PDB:7oniR	0.096	0.309	1.019	86	0.034	0.163	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
17	PDB:5gm6a	0.071	0.217	1.339	123	0.039	0.130	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:7a1gM	0.078	0.466	1.535	53	0.024	0.189	7a1gM.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
19	PDB:7ejuB	0.082	0.514	1.535	52	0.031	0.250	7ejuB.pdb.gz	Structural basis for recognition and regulation of arenavirus polymerase L by Z protein.
20	PDB:7zs96	0.076	0.082	1.644	383	0.048	0.052	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15976	0.0	827	413	1.000	1.000	GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens OX=9606 GN=GATA1 PE=1 SV=1
2	P17679	0.0	654	413	0.860	0.860	GATA1_MOUSE Erythroid transcription factor OS=Mus musculus OX=10090 GN=Gata1 PE=1 SV=1
3	P43429	0.0	655	413	0.862	0.862	GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus OX=10116 GN=Gata1 PE=2 SV=1
4	Q90410	2.34e-86	271	418	0.409	0.404	Q90410_DANRE GATA binding protein 1a OS=Danio rerio OX=7955 GN=zg1 PE=2 SV=1
5	P23767	4.89e-84	263	359	0.385	0.443	GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis OX=8355 GN=gata1-a PE=2 SV=1
6	P17678	3.79e-76	240	304	0.281	0.382	GATA1_CHICK Erythroid transcription factor OS=Gallus gallus OX=9031 GN=GATA1 PE=1 SV=1
7	Q6DG89	2.33e-70	229	427	0.291	0.281	Q6DG89_DANRE Endothelial transcription factor GATA-2 OS=Danio rerio OX=7955 GN=zgc:91840 PE=2 SV=1
8	F1QD30	3.63e-70	229	428	0.291	0.280	F1QD30_DANRE Endothelial transcription factor GATA-2 isoform X1 OS=Danio rerio OX=7955 GN=zgc:91840 PE=4 SV=1
9	P23769	6.94e-70	230	480	0.300	0.258	GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens OX=9606 GN=GATA2 PE=1 SV=3
10	O09100	2.23e-69	228	480	0.298	0.256	GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus OX=10090 GN=Gata2 PE=1 SV=2
11	P23824	2.37e-68	225	466	0.295	0.262	GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus OX=9031 GN=GATA2 PE=2 SV=1
12	Q924Y4	5.06e-68	225	480	0.295	0.254	GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus OX=10116 GN=Gata2 PE=1 SV=1
13	P23772	6.49e-68	224	443	0.252	0.235	GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus OX=10090 GN=Gata3 PE=1 SV=1
14	P23825	8.41e-68	223	444	0.252	0.234	GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus OX=9031 GN=GATA3 PE=2 SV=1
15	P23771	7.25e-67	221	443	0.249	0.233	GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens OX=9606 GN=GATA3 PE=1 SV=1
16	Q91428	1.15e-65	218	438	0.225	0.212	GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio OX=7955 GN=gata3 PE=2 SV=1
17	Q7T3G1	1.07e-62	210	456	0.247	0.224	Q7T3G1_DANRE GATA-binding protein 2a OS=Danio rerio OX=7955 GN=gata2 PE=2 SV=1
18	P91623	3.88e-61	207	486	0.223	0.189	GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster OX=7227 GN=grn PE=2 SV=1
19	Q91677	1.72e-59	200	392	0.235	0.247	GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis OX=8355 GN=gata4 PE=2 SV=1
20	P43691	6.27e-59	198	380	0.242	0.263	GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus OX=9031 GN=GATA4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08792 A2L_zn_ribbon	20	16.3	A2L zinc ribbon domain
2	PF01412 ArfGap	3.9e+02	12.5	Putative GTPase activating protein for Arf
3	PF09526 DUF2387	4.9e+02	12.1	Probable metal-binding protein (DUF2387)
4	PF12773 DZR	6.9e+02	11.7	Double zinc ribbon
5	PF18912 DZR_2	3.2e+02	12.7	Double zinc ribbon domain
6	PF00320 GATA	8.6e-26	100.6	GATA zinc finger
7	PF18694 TDP43_N	3.2e+02	12.6	Transactive response DNA-binding protein N-terminal domain
8	PF08271 TF_Zn_Ribbon	0.026	25.4	TFIIB zinc-binding
9	PF09723 Zn-ribbon_8	32	16.1	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365858

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257818	0.999	Rhombotin-2
2	9606.ENSP00000294339	0.999	T-cell acute lymphocytic leukemia protein 1
3	9606.ENSP00000326630	0.999	Zinc finger protein ZFPM1
4	9606.ENSP00000305918	0.996	Bromodomain-containing protein 3
5	9606.ENSP00000392466	0.996	LIM domain-binding protein 1
6	9606.ENSP00000227163	0.995	Transcription factor PU.1
7	9606.ENSP00000263253	0.994	Histone acetyltransferase p300
8	9606.ENSP00000262965	0.990	Transcription factor E2-alpha
9	9606.ENSP00000306772	0.988	LIM domain-binding protein 2
10	9606.ENSP00000338774	0.983	B-cell lymphoma/leukemia 11A
11	9606.ENSP00000339992	0.983	Transcriptional activator Myb
12	9606.ENSP00000225983	0.980	Histone deacetylase 5
13	9606.ENSP00000362649	0.980	Histone deacetylase 1
14	9606.ENSP00000384179	0.975	Zinc finger protein ZFPM2
15	9606.ENSP00000262407	0.968	Integrin alpha-IIb
16	9606.ENSP00000307199	0.966	Alpha-hemoglobin-stabilizing protein
17	9606.ENSP00000362592	0.964	Histone-binding protein RBBP4
18	9606.ENSP00000333994	0.958	Hemoglobin subunit beta
19	9606.ENSP00000264834	0.955	Krueppel-like factor 1
20	9606.ENSP00000439120	0.951	Transcription factor NF-E2 45 kDa subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0001221	1.000	transcription coregulator binding
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0031490	0.935	chromatin DNA binding
GO:0019904	0.930	protein domain specific binding
GO:0070742	0.552	C2H2 zinc finger domain binding
GO:0001223	0.472	transcription coactivator binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.993	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0032502	0.980	developmental process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0009889	0.976	regulation of biosynthetic process
GO:0080090	0.975	regulation of primary metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0019219	0.970	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0048856	0.964	anatomical structure development
GO:0010556	0.958	regulation of macromolecule biosynthetic process
GO:0031326	0.958	regulation of cellular biosynthetic process
GO:0032501	0.956	multicellular organismal process
GO:0010468	0.953	regulation of gene expression
GO:1903506	0.945	regulation of nucleic acid-templated transcription
GO:0048522	0.943	positive regulation of cellular process
GO:0006355	0.943	regulation of DNA-templated transcription
GO:0048869	0.938	cellular developmental process
GO:0009893	0.937	positive regulation of metabolic process
GO:0010604	0.933	positive regulation of macromolecule metabolic process
GO:0050896	0.926	response to stimulus
GO:0051254	0.917	positive regulation of RNA metabolic process
GO:0010557	0.915	positive regulation of macromolecule biosynthetic process
GO:0031328	0.915	positive regulation of cellular biosynthetic process
GO:0006357	0.913	regulation of transcription by RNA polymerase II
GO:0045893	0.909	positive regulation of DNA-templated transcription
GO:0030154	0.896	cell differentiation
GO:0048519	0.894	negative regulation of biological process
GO:0045944	0.878	positive regulation of transcription by RNA polymerase II
GO:0048523	0.872	negative regulation of cellular process
GO:0010605	0.837	negative regulation of macromolecule metabolic process
GO:0051172	0.661	negative regulation of nitrogen compound metabolic process
GO:0031324	0.657	negative regulation of cellular metabolic process
GO:0051239	0.648	regulation of multicellular organismal process
GO:0051716	0.583	cellular response to stimulus
GO:0008152	0.559	metabolic process
GO:0007275	0.555	multicellular organism development
GO:0071704	0.541	organic substance metabolic process
GO:0010558	0.526	negative regulation of macromolecule biosynthetic process
GO:0031327	0.525	negative regulation of cellular biosynthetic process
GO:0045934	0.518	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.514	negative regulation of RNA metabolic process
GO:0044238	0.504	primary metabolic process
GO:0042221	0.501	response to chemical
GO:0045892	0.487	negative regulation of DNA-templated transcription
GO:0050793	0.474	regulation of developmental process
GO:0048468	0.472	cell development
GO:0002376	0.471	immune system process
GO:0000122	0.471	negative regulation of transcription by RNA polymerase II
GO:0006807	0.445	nitrogen compound metabolic process
GO:0048583	0.435	regulation of response to stimulus
GO:0044237	0.432	cellular metabolic process
GO:0048513	0.395	animal organ development
GO:0030097	0.391	hemopoiesis
GO:0051246	0.376	regulation of protein metabolic process
GO:0009888	0.370	tissue development
GO:0043170	0.340	macromolecule metabolic process
GO:0009966	0.340	regulation of signal transduction
GO:0006950	0.339	response to stress
GO:0065009	0.336	regulation of molecular function
GO:0030099	0.326	myeloid cell differentiation
GO:0048731	0.304	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.986	nuclear lumen
GO:0005654	0.984	nucleoplasm
GO:0032991	0.938	protein-containing complex
GO:0005667	0.642	transcription regulator complex
GO:0005737	0.384	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]