StarFunc result for job id P16035

User Input

>input (220 residues)
MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGND
IYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDG
KMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTE
KNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16035	1.000	1.000	9.775E-50	220	1.000	1.000	P16035.pdb.gz	TIMP2_HUMAN Metalloproteinase inhibitor 2 OS=Homo sapiens OX=9606 GN=TIMP2 PE=1 SV=2
2	AFDB:Q1MTE8	0.906	0.906	4.380E-40	220	0.709	0.709	Q1MTE8.pdb.gz
3	AFDB:Q64HW8	0.947	0.947	1.187E-37	220	0.659	0.659	Q64HW8.pdb.gz	Q64HW8_ONCMY TIMP metallopeptidase inhibitor 2b OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
4	PDB:1gxdC	0.803	0.915	1.765E-35	192	0.873	1.000	1gxdC.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
5	AFDB:P81556	0.803	0.789	7.415E-29	224	0.477	0.469	P81556.pdb.gz	TIMP4_RAT Metalloproteinase inhibitor 4 OS=Rattus norvegicus OX=10116 GN=Timp4 PE=2 SV=2
6	AFDB:P35625	0.779	0.811	7.319E-26	211	0.409	0.427	P35625.pdb.gz	TIMP3_HUMAN Metalloproteinase inhibitor 3 OS=Homo sapiens OX=9606 GN=TIMP3 PE=1 SV=2
7	AFDB:P30120	0.733	0.742	1.337E-22	217	0.377	0.382	P30120.pdb.gz	TIMP1_RAT Metalloproteinase inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Timp1 PE=1 SV=2
8	AFDB:P01033	0.689	0.730	2.798E-22	207	0.377	0.401	P01033.pdb.gz	TIMP1_HUMAN Metalloproteinase inhibitor 1 OS=Homo sapiens OX=9606 GN=TIMP1 PE=1 SV=1
9	AFDB:A0A2R8Q0U9	0.713	0.687	1.304E-21	229	0.391	0.376	A0A2R8Q0U9.pdb.gz	A0A2R8Q0U9_DANRE Metalloproteinase inhibitor 2-like OS=Danio rerio OX=7955 GN=timp4.1 PE=3 SV=1
10	AFDB:P12032	0.695	0.742	9.350E-21	205	0.359	0.385	P12032.pdb.gz	TIMP1_MOUSE Metalloproteinase inhibitor 1 OS=Mus musculus OX=10090 GN=Timp1 PE=1 SV=2
11	PDB:1ueaB	0.693	0.831	2.392E-20	181	0.332	0.403	1ueaB.pdb.gz	Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
12	AFDB:Q9VH14	0.655	0.684	1.270E-15	210	0.259	0.271	Q9VH14.pdb.gz	TIMP_DROME Tissue inhibitor of metalloproteinase OS=Drosophila melanogaster OX=7227 GN=Timp PE=1 SV=1
13	PDB:4v6wAX	0.195	0.264	1.030E-1	143	0.059	0.091	4v6wAX.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	PDB:7a1gc	0.178	0.242	1.030E-1	144	0.064	0.097	7a1gc.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
15	PDB:6zxgj	0.208	0.325	1.165E-1	116	0.064	0.121	6zxgj.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
16	PDB:5eanA	0.232	0.061	1.318E-1	1051	0.068	0.014	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
17	PDB:1gvpA	0.227	0.446	1.491E-1	87	0.059	0.149	1gvpA.pdb.gz
18	PDB:6d6qI	0.238	0.277	1.686E-1	183	0.055	0.066	6d6qI.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
19	PDB:4a2iL	0.193	0.301	2.028E-1	123	0.045	0.081	4a2iL.pdb.gz	Cryo-Electron Microscopy Structure of the 30S Subunit in Complex with the Yjeq Biogenesis Factor.
20	PDB:6fyxi	0.201	0.316	2.028E-1	121	0.050	0.091	6fyxi.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16035	5.71e-167	460	220	1.000	1.000	TIMP2_HUMAN Metalloproteinase inhibitor 2 OS=Homo sapiens OX=9606 GN=TIMP2 PE=1 SV=2
2	P30121	4.37e-164	453	220	0.982	0.982	TIMP2_RAT Metalloproteinase inhibitor 2 OS=Rattus norvegicus OX=10116 GN=Timp2 PE=1 SV=3
3	P25785	3.71e-163	451	220	0.973	0.973	TIMP2_MOUSE Metalloproteinase inhibitor 2 OS=Mus musculus OX=10090 GN=Timp2 PE=1 SV=2
4	Q7SZM6	2.49e-119	340	220	0.709	0.709	Q7SZM6_DANRE Metalloproteinase inhibitor 2 precursor OS=Danio rerio OX=7955 GN=etID32613.12 PE=2 SV=1
5	Q64HW8	5.62e-109	313	220	0.655	0.655	Q64HW8_ONCMY TIMP metallopeptidase inhibitor 2b OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
6	Q9JHB3	3.43e-70	215	224	0.450	0.442	TIMP4_MOUSE Metalloproteinase inhibitor 4 OS=Mus musculus OX=10090 GN=Timp4 PE=2 SV=1
7	P81556	3.50e-70	215	224	0.450	0.442	TIMP4_RAT Metalloproteinase inhibitor 4 OS=Rattus norvegicus OX=10116 GN=Timp4 PE=2 SV=2
8	P35625	1.50e-63	198	211	0.409	0.427	TIMP3_HUMAN Metalloproteinase inhibitor 3 OS=Homo sapiens OX=9606 GN=TIMP3 PE=1 SV=2
9	P39876	1.86e-62	195	211	0.423	0.441	TIMP3_MOUSE Metalloproteinase inhibitor 3 OS=Mus musculus OX=10090 GN=Timp3 PE=1 SV=1
10	P48032	1.82e-61	192	211	0.418	0.436	TIMP3_RAT Metalloproteinase inhibitor 3 OS=Rattus norvegicus OX=10116 GN=Timp3 PE=2 SV=1
11	A0A2R8Q0U9	3.22e-49	162	229	0.386	0.371	A0A2R8Q0U9_DANRE Metalloproteinase inhibitor 2-like OS=Danio rerio OX=7955 GN=timp4.1 PE=3 SV=1
12	P01033	3.09e-48	159	207	0.386	0.411	TIMP1_HUMAN Metalloproteinase inhibitor 1 OS=Homo sapiens OX=9606 GN=TIMP1 PE=1 SV=1
13	P30120	8.42e-38	132	217	0.332	0.336	TIMP1_RAT Metalloproteinase inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Timp1 PE=1 SV=2
14	P12032	6.85e-37	130	205	0.323	0.346	TIMP1_MOUSE Metalloproteinase inhibitor 1 OS=Mus musculus OX=10090 GN=Timp1 PE=1 SV=2
15	Q9VH14	2.39e-13	68.6	210	0.195	0.205	TIMP_DROME Tissue inhibitor of metalloproteinase OS=Drosophila melanogaster OX=7227 GN=Timp PE=1 SV=1
16	A1Z199	1.5	30.4	97	0.073	0.165	A1Z199_HUMAN BCR/ABL p210 fusion protein (Fragment) OS=Homo sapiens OX=9606 GN=BCR/ABL fusion PE=1 SV=1
17	P0AAN3	3.8	30.8	290	0.123	0.093	HYPB_ECOLI Hydrogenase maturation factor HypB OS=Escherichia coli (strain K12) OX=83333 GN=hypB PE=1 SV=1
18	P00519	4.6	30.8	1130	0.073	0.014	ABL1_HUMAN Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4
19	E9PT20	4.7	30.8	1143	0.073	0.014	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
20	Q2PYT4	4.7	30.8	1143	0.073	0.014	Q2PYT4_RAT Tyrosine-protein kinase (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01759 NTR	2.8	19.2	UNC-6/NTR/C345C module
2	PF00965 TIMP	4.5e-74	259.7	Tissue inhibitor of metalloproteinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262768

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219070	0.999	72 kDa type IV collagenase
2	9606.ENSP00000308208	0.999	Matrix metalloproteinase-14
3	9606.ENSP00000265983	0.989	Hemopexin
4	9606.ENSP00000260302	0.976	Collagenase 3
5	9606.ENSP00000286614	0.975	Matrix metalloproteinase-16
6	9606.ENSP00000279441	0.968	Stromelysin-2
7	9606.ENSP00000299855	0.966	Stromelysin-1
8	9606.ENSP00000367202	0.961	Reversion-inducing cysteine-rich protein with Kazal motifs
9	9606.ENSP00000322788	0.950	Interstitial collagenase
10	9606.ENSP00000337816	0.936	Matrix metalloproteinase-25
11	9606.ENSP00000361405	0.936	Matrix metalloproteinase-9
12	9606.ENSP00000219271	0.924	Matrix metalloproteinase-15
13	9606.ENSP00000260227	0.918	Matrilysin
14	9606.ENSP00000353767	0.910	Matrix metalloproteinase-17
15	9606.ENSP00000349677	0.903	Testican-3
16	9606.ENSP00000268035	0.895	Insulin-like growth factor 1 receptor
17	9606.ENSP00000246186	0.865	Matrix metalloproteinase-24
18	9606.ENSP00000236826	0.857	Neutrophil collagenase
19	9606.ENSP00000295666	0.777	Insulin-like growth factor-binding protein 7
20	9606.ENSP00000215743	0.774	Stromelysin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008191	1.000	metalloendopeptidase inhibitor activity
GO:0005102	0.921	signaling receptor binding
GO:0046872	0.820	metal ion binding
GO:0046914	0.778	transition metal ion binding
GO:0019899	0.739	enzyme binding
GO:0008270	0.715	zinc ion binding
GO:0002020	0.683	protease binding
GO:0044877	0.637	protein-containing complex binding
GO:0140677	0.504	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0048583	0.989	regulation of response to stimulus
GO:0065009	0.983	regulation of molecular function
GO:0048519	0.981	negative regulation of biological process
GO:1902531	0.979	regulation of intracellular signal transduction
GO:0043408	0.972	regulation of MAPK cascade
GO:0042221	0.959	response to chemical
GO:0050793	0.957	regulation of developmental process
GO:0048523	0.947	negative regulation of cellular process
GO:0060255	0.945	regulation of macromolecule metabolic process
GO:0042127	0.942	regulation of cell population proliferation
GO:0051246	0.935	regulation of protein metabolic process
GO:0050790	0.930	regulation of catalytic activity
GO:0009987	0.928	cellular process
GO:0010033	0.927	response to organic substance
GO:0008285	0.903	negative regulation of cell population proliferation
GO:0045595	0.888	regulation of cell differentiation
GO:0045664	0.882	regulation of neuron differentiation
GO:0048518	0.876	positive regulation of biological process
GO:0032501	0.869	multicellular organismal process
GO:0048522	0.865	positive regulation of cellular process
GO:0043086	0.859	negative regulation of catalytic activity
GO:0051248	0.846	negative regulation of protein metabolic process
GO:0030162	0.835	regulation of proteolysis
GO:0032502	0.830	developmental process
GO:0051336	0.829	regulation of hydrolase activity
GO:0051716	0.794	cellular response to stimulus
GO:0045861	0.790	negative regulation of proteolysis
GO:0009968	0.784	negative regulation of signal transduction
GO:1902532	0.732	negative regulation of intracellular signal transduction
GO:0048856	0.658	anatomical structure development
GO:0007275	0.574	multicellular organism development
GO:0048584	0.430	positive regulation of response to stimulus
GO:0070887	0.400	cellular response to chemical stimulus
GO:0010647	0.385	positive regulation of cell communication
GO:0023056	0.382	positive regulation of signaling
GO:0051346	0.336	negative regulation of hydrolase activity
GO:0052547	0.329	regulation of peptidase activity
GO:0031323	0.326	regulation of cellular metabolic process
GO:0009967	0.322	positive regulation of signal transduction
GO:0008152	0.312	metabolic process
GO:0010466	0.310	negative regulation of peptidase activity
GO:0048731	0.302	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0071944	0.997	cell periphery
GO:0070013	0.993	intracellular organelle lumen
GO:0012505	0.987	endomembrane system
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0062023	0.977	collagen-containing extracellular matrix
GO:0005737	0.969	cytoplasm
GO:0031982	0.925	vesicle
GO:0031410	0.884	cytoplasmic vesicle
GO:0030141	0.727	secretory granule
GO:0016020	0.707	membrane
GO:0005886	0.407	plasma membrane
GO:0009986	0.362	cell surface
GO:0031983	0.345	vesicle lumen
GO:0060205	0.343	cytoplasmic vesicle lumen
GO:0065010	0.336	extracellular membrane-bounded organelle
GO:0070062	0.330	extracellular exosome
GO:0005654	0.317	nucleoplasm
GO:0034774	0.307	secretory granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]