StarFunc result for job id P16050

User Input

>input (662 residues)
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPL
LFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP
QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAK
GLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV
LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL
VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH
LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVS
LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQH
ASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ
PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSV
AI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16050	1.000	1.000	0.000	662	1.000	1.000	P16050.pdb.gz	LOX15_HUMAN Polyunsaturated fatty acid lipoxygenase ALOX15 OS=Homo sapiens OX=9606 GN=ALOX15 PE=1 SV=3
2	AFDB:P27479	0.999	0.997	0.000	663	0.869	0.867	P27479.pdb.gz	LOX15_BOVIN Polyunsaturated fatty acid lipoxygenase ALOX15 OS=Bos taurus OX=9913 GN=ALOX15 PE=1 SV=3
3	AFDB:P12530	0.998	0.997	3.755E-100	663	0.810	0.808	P12530.pdb.gz	LOX15_RABIT Polyunsaturated fatty acid lipoxygenase ALOX15 OS=Oryctolagus cuniculus OX=9986 GN=ALOX15 PE=1 SV=3
4	AFDB:P16469	0.995	0.993	7.862E-100	663	0.866	0.864	P16469.pdb.gz	LOX15_PIG Polyunsaturated fatty acid lipoxygenase ALOX15 OS=Sus scrofa OX=9823 GN=ALOX15 PE=1 SV=3
5	AFDB:P39654	0.996	0.995	1.344E-95	663	0.737	0.736	P39654.pdb.gz	LOX15_MOUSE Polyunsaturated fatty acid lipoxygenase ALOX15 OS=Mus musculus OX=10090 GN=Alox15 PE=1 SV=4
6	PDB:2p0mA	0.991	0.991	3.081E-91	662	0.810	0.810	2p0mA.pdb.gz	Conformational flexibility in mammalian 15S-lipoxygenase: Reinterpretation of the crystallographic data.
7	AFDB:D3ZQF9	0.986	0.986	1.468E-89	662	0.681	0.681	D3ZQF9.pdb.gz	LX12E_RAT Polyunsaturated fatty acid (12S)/(13S)-lipoxygenase, epidermal-type OS=Rattus norvegicus OX=10116 GN=Alox12e PE=3 SV=1
8	AFDB:P18054	0.990	0.988	1.412E-88	663	0.656	0.655	P18054.pdb.gz	LOX12_HUMAN Polyunsaturated fatty acid lipoxygenase ALOX12 OS=Homo sapiens OX=9606 GN=ALOX12 PE=1 SV=4
9	AFDB:F1LQ70	0.987	0.986	5.257E-85	663	0.639	0.638	F1LQ70.pdb.gz	LOX12_RAT Polyunsaturated fatty acid lipoxygenase ALOX12 OS=Rattus norvegicus OX=10116 GN=Alox12 PE=1 SV=1
10	AFDB:Q7T2A9	0.950	0.939	4.350E-66	670	0.447	0.442	Q7T2A9.pdb.gz	Q7T2A9_DANRE Arachidonate 12-lipoxygenase OS=Danio rerio OX=7955 GN=wu:fb72a11 PE=1 SV=1
11	AFDB:P09917	0.945	0.928	3.344E-64	674	0.400	0.393	P09917.pdb.gz	LOX5_HUMAN Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=2
12	PDB:6ncfB	0.941	0.922	2.631E-61	676	0.400	0.392	6ncfB.pdb.gz	Structural and mechanistic insights into 5-lipoxygenase inhibition by natural products.
13	PDB:7ttjA	0.904	0.930	1.831E-60	643	0.387	0.398	7ttjA.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
14	PDB:4nreA	0.954	0.936	9.220E-60	675	0.381	0.373	4nreA.pdb.gz	The structure of human 15-lipoxygenase-2 with a substrate mimic.
15	PDB:3v99B	0.885	0.916	7.423E-58	639	0.376	0.390	3v99B.pdb.gz	Conversion of human 5-lipoxygenase to a 15-lipoxygenase by a point mutation to mimic phosphorylation at Serine-663.
16	PDB:7ttlC	0.879	0.942	1.484E-57	617	0.376	0.404	7ttlC.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
17	PDB:7ttjB	0.834	0.933	5.787E-54	590	0.364	0.408	7ttjB.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
18	PDB:1ygeA	0.875	0.700	1.206E-34	839	0.245	0.193	1ygeA.pdb.gz	Crystal structure of soybean lipoxygenase L-1 at 1.4 A resolution.
19	PDB:2iukA	0.864	0.694	4.427E-33	835	0.252	0.200	2iukA.pdb.gz	Crystal Structures of Vegetative Soybean Lipoxygenase Vlx-B and Vlx-D, and Comparisons with Seed Isoforms Lox-1 and Lox-3.
20	PDB:5fnoA	0.685	0.788	2.212E-20	568	0.172	0.201	5fnoA.pdb.gz	Crystal Structure of Manganese Lipoxygenase of the Rice Blast Fungus Magnaporthe Oryzae

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZQF9	0.0	941	662	0.681	0.681	LX12E_RAT Polyunsaturated fatty acid (12S)/(13S)-lipoxygenase, epidermal-type OS=Rattus norvegicus OX=10116 GN=Alox12e PE=3 SV=1
2	F1LQ70	0.0	887	663	0.639	0.638	LOX12_RAT Polyunsaturated fatty acid lipoxygenase ALOX12 OS=Rattus norvegicus OX=10116 GN=Alox12 PE=1 SV=1
3	P12530	0.0	1134	663	0.813	0.811	LOX15_RABIT Polyunsaturated fatty acid lipoxygenase ALOX15 OS=Oryctolagus cuniculus OX=9986 GN=ALOX15 PE=1 SV=3
4	P16050	0.0	1364	662	1.000	1.000	LOX15_HUMAN Polyunsaturated fatty acid lipoxygenase ALOX15 OS=Homo sapiens OX=9606 GN=ALOX15 PE=1 SV=3
5	P16469	0.0	1196	663	0.866	0.864	LOX15_PIG Polyunsaturated fatty acid lipoxygenase ALOX15 OS=Sus scrofa OX=9823 GN=ALOX15 PE=1 SV=3
6	P18054	0.0	897	663	0.656	0.655	LOX12_HUMAN Polyunsaturated fatty acid lipoxygenase ALOX12 OS=Homo sapiens OX=9606 GN=ALOX12 PE=1 SV=4
7	P27479	0.0	1211	663	0.869	0.867	LOX15_BOVIN Polyunsaturated fatty acid lipoxygenase ALOX15 OS=Bos taurus OX=9913 GN=ALOX15 PE=1 SV=3
8	P39654	0.0	1028	663	0.737	0.736	LOX15_MOUSE Polyunsaturated fatty acid lipoxygenase ALOX15 OS=Mus musculus OX=10090 GN=Alox15 PE=1 SV=4
9	P39655	0.0	887	663	0.637	0.637	LOX12_MOUSE Polyunsaturated fatty acid lipoxygenase ALOX12 OS=Mus musculus OX=10090 GN=Alox12 PE=1 SV=4
10	P55249	0.0	929	662	0.663	0.663	LX12E_MOUSE Polyunsaturated fatty acid (12S)/(13S)-lipoxygenase, epidermal-type OS=Mus musculus OX=10090 GN=Alox12e PE=1 SV=1
11	Q02759	0.0	1036	663	0.748	0.747	LOX15_RAT Polyunsaturated fatty acid lipoxygenase ALOX15 OS=Rattus norvegicus OX=10116 GN=Alox15 PE=1 SV=3
12	Q7T2A9	0.0	566	670	0.446	0.440	Q7T2A9_DANRE Arachidonate 12-lipoxygenase OS=Danio rerio OX=7955 GN=wu:fb72a11 PE=1 SV=1
13	P48999	4.07e-174	513	674	0.402	0.395	LOX5_MOUSE Polyunsaturated fatty acid 5-lipoxygenase OS=Mus musculus OX=10090 GN=Alox5 PE=1 SV=3
14	P09917	1.56e-173	512	674	0.406	0.399	LOX5_HUMAN Polyunsaturated fatty acid 5-lipoxygenase OS=Homo sapiens OX=9606 GN=ALOX5 PE=1 SV=2
15	P12527	5.71e-173	511	673	0.400	0.394	LOX5_RAT Polyunsaturated fatty acid 5-lipoxygenase OS=Rattus norvegicus OX=10116 GN=Alox5 PE=1 SV=3
16	B8A697	1.29e-165	492	674	0.378	0.371	B8A697_DANRE Arachidonate 5-lipoxygenase OS=Danio rerio OX=7955 GN=alox5 PE=3 SV=1
17	O35936	3.31e-152	457	677	0.387	0.378	ALOX8_MOUSE Polyunsaturated fatty acid lipoxygenase ALOX8 OS=Mus musculus OX=10090 GN=Alox8 PE=1 SV=1
18	Q9WV07	4.05e-147	446	711	0.382	0.356	LOXE3_MOUSE Hydroperoxide isomerase ALOXE3 OS=Mus musculus OX=10090 GN=Aloxe3 PE=1 SV=2
19	D3ZKX9	1.82e-146	444	711	0.387	0.360	LOXE3_RAT Hydroperoxide isomerase ALOXE3 OS=Rattus norvegicus OX=10116 GN=Aloxe3 PE=1 SV=1
20	Q8K4F2	1.96e-146	442	677	0.376	0.368	LX15B_RAT Polyunsaturated fatty acid lipoxygenase ALOX15B OS=Rattus norvegicus OX=10116 GN=Alox15b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00305 Lipoxygenase	2.2e-54	196.7	Lipoxygenase
2	PF01477 PLAT	8.9e-16	69.9	PLAT/LH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000458832

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261313	0.975	Phosphatidylethanolamine-binding protein 1
2	9606.ENSP00000356438	0.961	Prostaglandin G/H synthase 2
3	9606.ENSP00000354612	0.960	Prostaglandin G/H synthase 1
4	9606.ENSP00000231449	0.948	Interleukin-4
5	9606.ENSP00000304915	0.944	Interleukin-13
6	9606.ENSP00000360247	0.927	Cytochrome P450 2J2
7	9606.ENSP00000221307	0.926	Docosahexaenoic acid omega-hydroxylase CYP4F3
8	9606.ENSP00000260682	0.922	Cytochrome P450 2C9
9	9606.ENSP00000360372	0.917	Cytochrome P450 2C19
10	9606.ENSP00000221700	0.913	Phylloquinone omega-hydroxylase CYP4F2
11	9606.ENSP00000315167	0.913	Arachidonate 12-lipoxygenase, 12R-type
12	9606.ENSP00000363512	0.912	Arachidonate 5-lipoxygenase
13	9606.ENSP00000369530	0.912	Arachidonate 15-lipoxygenase B
14	9606.ENSP00000311095	0.911	Cytochrome P450 4A11
15	9606.ENSP00000440689	0.911	Cytochrome P450 2E1
16	9606.ENSP00000360317	0.910	Cytochrome P450 2C8
17	9606.ENSP00000333212	0.909	Cytochrome P450 2U1
18	9606.ENSP00000337915	0.909	Cytochrome P450 3A4
19	9606.ENSP00000360958	0.909	Cytochrome P450 4A22
20	9606.ENSP00000324648	0.907	Cytochrome P450 2B6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016702	0.999	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0005488	0.990	binding
GO:0005515	0.974	protein binding
GO:0004052	0.974	arachidonate 12(S)-lipoxygenase activity
GO:0016165	0.728	linoleate 13S-lipoxygenase activity
GO:0043167	0.470	ion binding
GO:0050473	0.450	arachidonate 15-lipoxygenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0019752	0.995	carboxylic acid metabolic process
GO:0006690	0.991	icosanoid metabolic process
GO:0001676	0.986	long-chain fatty acid metabolic process
GO:0019369	0.974	arachidonic acid metabolic process
GO:0019372	0.909	lipoxygenase pathway
GO:0065007	0.444	biological regulation
GO:0050896	0.415	response to stimulus
GO:0050789	0.378	regulation of biological process
GO:0050794	0.346	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0005886	0.987	plasma membrane
GO:0043226	0.959	organelle
GO:0043227	0.889	membrane-bounded organelle
GO:0043229	0.875	intracellular organelle
GO:0012505	0.848	endomembrane system
GO:0005576	0.763	extracellular region
GO:0043231	0.762	intracellular membrane-bounded organelle
GO:0005615	0.603	extracellular space
GO:0031982	0.509	vesicle
GO:0070062	0.466	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.13.11.-	0.999	With incorporation of two atoms of oxygen.
RHEA:10428	0.974	(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (12S)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate
EC:1.13.11.31	0.974	arachidonate 12-lipoxygenase.
RHEA:22780	0.728	(9Z,12Z)-octadecadienoate + O2 = (13S)-hydroperoxy-(9Z,11E)-octadecadienoate
EC:1.13.11.12	0.728	linoleate 13S-lipoxygenase.
RHEA:16869	0.450	(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = (15S)-hydroperoxy-(5Z,8Z,11Z,13E)-eicosatetraenoate
EC:1.13.11.33	0.450	arachidonate 15-lipoxygenase.

[back to server]