StarFunc result for job id P16066

User Input

>input (1061 residues)
MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVE
LALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVY
AAAPVGRFTAHWRVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWER
QALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGR
VIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDV
SARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLY
IQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGS
LSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNY
GSLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVG
ACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGN
LKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAG
DVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLM
QRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTL
LNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFR
IRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSET
KAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2KGK2	0.413	0.417	0.000	1051	0.586	0.592	A0A0G2KGK2.pdb.gz
2	AFDB:E7F3T9	0.615	0.613	0.000	1065	0.619	0.617	E7F3T9.pdb.gz
3	AFDB:P16066	1.000	1.000	0.000	1061	1.000	1.000	P16066.pdb.gz	ANPRA_HUMAN Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1
4	AFDB:P16067	0.594	0.601	0.000	1047	0.600	0.608	P16067.pdb.gz	ANPRB_RAT Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1
5	AFDB:Q1LX84	0.654	0.651	0.000	1067	0.619	0.616	Q1LX84.pdb.gz	Q1LX84_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=sGC PE=3 SV=1
6	AFDB:Q86GV3	0.360	0.301	0.000	1276	0.440	0.366	Q86GV3.pdb.gz	GCY28_CAEEL Receptor-type guanylate cyclase gcy-28 OS=Caenorhabditis elegans OX=6239 GN=gcy-28 PE=1 SV=1
7	AFDB:Q9VU79	0.578	0.508	3.766E-97	1250	0.373	0.317	Q9VU79.pdb.gz	Q9VU79_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=GYC PE=3 SV=2
8	AFDB:Q6TL19	0.404	0.392	2.286E-93	1100	0.352	0.340	Q6TL19.pdb.gz	GUC2G_MOUSE Guanylate cyclase 2G OS=Mus musculus OX=10090 GN=Gucy2g PE=1 SV=1
9	AFDB:P55205	0.403	0.391	3.151E-93	1100	0.344	0.332	P55205.pdb.gz	GUC2G_RAT Guanylate cyclase 2G OS=Rattus norvegicus OX=10116 GN=Gucy2g PE=2 SV=2
10	AFDB:Q7JQ32	0.511	0.397	2.960E-91	1525	0.361	0.251	Q7JQ32.pdb.gz	GC76C_DROME Receptor-type guanylate cyclase Gyc76C OS=Drosophila melanogaster OX=7227 GN=Gyc76C PE=1 SV=1
11	PDB:7c7sA	0.329	0.496	2.904E-22	685	0.084	0.130	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
12	PDB:7d9rA	0.213	0.435	1.606E-21	502	0.095	0.201	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
13	PDB:6w2xB	0.314	0.477	3.965E-20	669	0.082	0.130	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
14	PDB:6jt0A	0.209	0.402	6.081E-20	542	0.092	0.181	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
15	PDB:6jt0B	0.195	0.353	2.574E-19	576	0.096	0.177	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
16	PDB:7d9tA	0.199	0.404	2.864E-19	512	0.090	0.188	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
17	PDB:7yziA	0.195	0.522	2.069E-18	378	0.090	0.251	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
18	PDB:7e9gR	0.273	0.362	1.144E-17	769	0.061	0.085	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
19	PDB:7epcA	0.295	0.393	5.110E-17	782	0.064	0.087	7epcA.pdb.gz
20	PDB:7wihA	0.267	0.363	2.826E-16	741	0.057	0.081	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C7LAF5	0.0	609	1237	0.384	0.329	C7LAF5_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=CG10738-RA PE=2 SV=1
2	M9NFA6	0.0	610	1235	0.384	0.330	M9NFA6_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10738 PE=3 SV=1
3	P16066	0.0	2185	1061	1.000	1.000	ANPRA_HUMAN Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1
4	P16067	0.0	1257	1047	0.607	0.615	ANPRB_RAT Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1
5	P18293	0.0	1957	1057	0.891	0.894	ANPRA_MOUSE Atrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2
6	P18910	0.0	1956	1057	0.891	0.894	ANPRA_RAT Atrial natriuretic peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Npr1 PE=1 SV=1
7	P20594	0.0	1259	1047	0.605	0.613	ANPRB_HUMAN Atrial natriuretic peptide receptor 2 OS=Homo sapiens OX=9606 GN=NPR2 PE=1 SV=1
8	P55205	0.0	568	1100	0.367	0.354	GUC2G_RAT Guanylate cyclase 2G OS=Rattus norvegicus OX=10116 GN=Gucy2g PE=2 SV=2
9	Q1LX84	0.0	1368	1067	0.620	0.617	Q1LX84_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=sGC PE=3 SV=1
10	Q6TL19	0.0	560	1100	0.370	0.357	GUC2G_MOUSE Guanylate cyclase 2G OS=Mus musculus OX=10090 GN=Gucy2g PE=1 SV=1
11	Q6VVW5	0.0	1258	1047	0.607	0.615	ANPRB_MOUSE Atrial natriuretic peptide receptor 2 OS=Mus musculus OX=10090 GN=Npr2 PE=1 SV=2
12	Q7JQ32	0.0	587	1525	0.372	0.259	GC76C_DROME Receptor-type guanylate cyclase Gyc76C OS=Drosophila melanogaster OX=7227 GN=Gyc76C PE=1 SV=1
13	Q86GV3	0.0	622	1276	0.298	0.248	GCY28_CAEEL Receptor-type guanylate cyclase gcy-28 OS=Caenorhabditis elegans OX=6239 GN=gcy-28 PE=1 SV=1
14	Q8IQK2	0.0	605	1248	0.385	0.327	Q8IQK2_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=GYC PE=3 SV=2
15	Q9VU79	0.0	604	1250	0.385	0.326	Q9VU79_DROME Guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=GYC PE=3 SV=2
16	Q9XTY1	1.72e-170	530	1058	0.326	0.327	GCY22_CAEEL Receptor-type guanylate cyclase gcy-22 OS=Caenorhabditis elegans OX=6239 GN=gcy-22 PE=1 SV=2
17	F1QWF7	2.42e-165	518	1103	0.301	0.289	F1QWF7_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=RETGC-1 PE=3 SV=2
18	B3DHF2	3.23e-165	518	1107	0.301	0.288	B3DHF2_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=RETGC-1 PE=2 SV=1
19	H2L002	4.69e-165	518	1111	0.357	0.341	GCY7_CAEEL Receptor-type guanylate cyclase gcy-7 OS=Caenorhabditis elegans OX=6239 GN=gcy-7 PE=2 SV=1
20	P51842	1.97e-163	513	1108	0.310	0.297	GUC2F_RAT Retinal guanylyl cyclase 2 OS=Rattus norvegicus OX=10116 GN=Gucy2f PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	2.1e-46	170.3	Receptor family ligand binding region
2	PF17150 CHASE6_C	5.5e+02	12.6	C-terminal domain of two-partite extracellular sensor domain
3	PF13125 DUF3958	1.9e+02	13.7	Protein of unknown function (DUF3958)
4	PF00211 Guanylate_cyc	1.5e-67	238.3	Adenylate and Guanylate cyclase catalytic domain
5	PF07701 HNOBA	0.59	21.0	Heme NO binding associated
6	PF00069 Pkinase	9.5e-26	102.3	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	6.2e-35	132.3	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357669

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365651	0.999	Natriuretic peptides B
2	9606.ENSP00000365663	0.999	Natriuretic peptides A
3	9606.ENSP00000387159	0.973	C-type natriuretic peptide
4	9606.ENSP00000368455	0.901	Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
5	9606.ENSP00000369456	0.900	Inosine triphosphate pyrophosphatase
6	9606.ENSP00000347046	0.870	cGMP-specific 3',5'-cyclic phosphodiesterase
7	9606.ENSP00000334910	0.809	cGMP-dependent 3',5'-cyclic phosphodiesterase
8	9606.ENSP00000362282	0.808	Molybdenum cofactor biosynthesis protein 1
9	9606.ENSP00000419045	0.808	GTP cyclohydrolase 1
10	9606.ENSP00000341083	0.807	Atrial natriuretic peptide receptor 2
11	9606.ENSP00000377061	0.777	Plexin-A1
12	9606.ENSP00000420295	0.773	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta
13	9606.ENSP00000291539	0.771	High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
14	9606.ENSP00000394842	0.764	Grancalcin
15	9606.ENSP00000363092	0.762	cGMP-dependent protein kinase 1
16	9606.ENSP00000255266	0.757	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
17	9606.ENSP00000286063	0.748	Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
18	9606.ENSP00000438284	0.744	cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
19	9606.ENSP00000410309	0.742	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A
20	9606.ENSP00000379496	0.736	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0004383	0.999	guanylate cyclase activity
GO:0060089	0.998	molecular transducer activity
GO:0005515	0.980	protein binding
GO:0038023	0.978	signaling receptor activity
GO:0001653	0.968	peptide receptor activity
GO:0042562	0.921	hormone binding
GO:0017046	0.900	peptide hormone binding
GO:0016941	0.430	natriuretic peptide receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.991	biological regulation
GO:0009987	0.987	cellular process
GO:0050896	0.985	response to stimulus
GO:0050789	0.978	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0032501	0.964	multicellular organismal process
GO:0051716	0.946	cellular response to stimulus
GO:0023052	0.945	signaling
GO:0007154	0.937	cell communication
GO:0003013	0.934	circulatory system process
GO:0007165	0.905	signal transduction
GO:0008152	0.892	metabolic process
GO:0071704	0.863	organic substance metabolic process
GO:0008015	0.825	blood circulation
GO:0044237	0.822	cellular metabolic process
GO:0008217	0.821	regulation of blood pressure
GO:0044238	0.802	primary metabolic process
GO:0006807	0.779	nitrogen compound metabolic process
GO:0055086	0.710	nucleobase-containing small molecule metabolic process
GO:1901564	0.687	organonitrogen compound metabolic process
GO:0009117	0.637	nucleotide metabolic process
GO:0052652	0.623	cyclic purine nucleotide metabolic process
GO:0007166	0.622	cell surface receptor signaling pathway
GO:0009058	0.528	biosynthetic process
GO:1901576	0.523	organic substance biosynthetic process
GO:0044249	0.523	cellular biosynthetic process
GO:0007167	0.470	enzyme-linked receptor protein signaling pathway
GO:0044271	0.368	cellular nitrogen compound biosynthetic process
GO:1901362	0.354	organic cyclic compound biosynthetic process
GO:0048518	0.350	positive regulation of biological process
GO:0019438	0.333	aromatic compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.968	protein-containing complex
GO:0043235	0.896	receptor complex
GO:0005622	0.776	intracellular anatomical structure
GO:0043226	0.748	organelle
GO:0043227	0.741	membrane-bounded organelle
GO:0005737	0.708	cytoplasm
GO:0043229	0.310	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13665	0.999	GTP = 3',5'-cyclic GMP + diphosphate
EC:4.6.1.2	0.999	guanylate cyclase.

[back to server]