StarFunc result for job id P16070

User Input

>input (742 residues)
MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSS
GSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQE
TWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDD
EDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWN
PEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS
HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSIT
LQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDV
TGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNR
SLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLAL
ALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSET
PDQFMTADETRNLQNVDMKIGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16070	1.000	1.000	0.000	742	1.000	1.000	P16070.pdb.gz	CD44_HUMAN CD44 antigen OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=3
2	AFDB:K7GND9	0.260	0.274	3.030E-75	700	0.718	0.761	K7GND9.pdb.gz	K7GND9_PIG CD44 antigen OS=Sus scrofa OX=9823 GN=CD44 PE=1 SV=3
3	AFDB:F1SGT4	0.287	0.279	2.697E-72	767	0.728	0.704	F1SGT4.pdb.gz	F1SGT4_PIG CD44 antigen OS=Sus scrofa OX=9823 GN=CD44 PE=1 SV=3
4	AFDB:P15379	0.364	0.350	5.931E-72	778	0.701	0.668	P15379.pdb.gz	CD44_MOUSE CD44 antigen OS=Mus musculus OX=10090 GN=Cd44 PE=1 SV=3
5	AFDB:K7GN90	0.264	0.263	1.027E-69	745	0.704	0.701	K7GN90.pdb.gz	K7GN90_PIG CD44 antigen OS=Sus scrofa OX=9823 GN=CD44 PE=1 SV=3
6	AFDB:P26051	0.270	0.388	7.800E-52	503	0.515	0.759	P26051.pdb.gz	CD44_RAT CD44 antigen OS=Rattus norvegicus OX=10116 GN=Cd44 PE=1 SV=2
7	AFDB:P55066	0.113	0.067	1.135E-5	1268	0.159	0.093	P55066.pdb.gz	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
8	AFDB:F8W252	0.123	0.069	1.206E-5	1373	0.144	0.078	F8W252.pdb.gz
9	PDB:6rkwD	0.103	0.099	3.847E-3	781	0.020	0.019	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
10	AFDB:A0A2R8QK78	0.125	0.062	2.222E-2	1570	0.168	0.080	A0A2R8QK78.pdb.gz
11	AFDB:Q9W468	0.090	0.082	2.832E-2	873	0.154	0.131	Q9W468.pdb.gz	Q9W468_DROME GH28601p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15765 PE=2 SV=2
12	PDB:7p8vA	0.075	0.136	3.212E-2	331	0.030	0.066	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
13	PDB:6zy7B	0.086	0.062	6.649E-2	1160	0.023	0.015	6zy7B.pdb.gz	Structural basis for allosteric regulation of Human Topoisomerase II alpha.
14	PDB:2q2eB	0.093	0.111	9.567E-2	581	0.023	0.029	2q2eB.pdb.gz
15	PDB:7kclB	0.062	0.071	3.028E-1	614	0.016	0.020	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
16	PDB:2zbkB	0.073	0.097	4.100E-1	506	0.026	0.038	2zbkB.pdb.gz	Crystal Structure of an Intact Type II DNA Topoisomerase: Insights into DNA Transfer Mechanisms
17	PDB:5tthA	0.068	0.073	7.518E-1	671	0.013	0.015	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
18	PDB:5tthB	0.093	0.106	9.582E-1	621	0.023	0.027	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
19	PDB:7ru7A	0.061	0.093	1.298	412	0.027	0.049	7ru7A.pdb.gz	Crystal structure of BtrK, a decarboxylase involved in the (S)-4-amino-2-hydroxybutyrate (AHBA) formation during butirosin biosynthesis
20	PDB:7kw7B	0.081	0.092	1.465	628	0.028	0.033	7kw7B.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SGT4	0.0	949	767	0.728	0.704	F1SGT4_PIG CD44 antigen OS=Sus scrofa OX=9823 GN=CD44 PE=1 SV=3
2	K7GND9	0.0	947	700	0.718	0.761	K7GND9_PIG CD44 antigen OS=Sus scrofa OX=9823 GN=CD44 PE=1 SV=3
3	P15379	0.0	950	778	0.708	0.675	CD44_MOUSE CD44 antigen OS=Mus musculus OX=10090 GN=Cd44 PE=1 SV=3
4	P16070	0.0	1536	742	1.000	1.000	CD44_HUMAN CD44 antigen OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=3
5	K7GN90	1.55e-117	364	494	0.239	0.358	K7GN90_PIG CD44 antigen OS=Sus scrofa OX=9823 GN=CD44 PE=1 SV=3
6	P26051	3.97e-104	330	503	0.239	0.352	CD44_RAT CD44 antigen OS=Rattus norvegicus OX=10116 GN=Cd44 PE=1 SV=2
7	H0YEV3	2.51e-96	300	243	0.235	0.716	H0YEV3_HUMAN CD44 molecule (Indian blood group) (Fragment) OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=2
8	H0YD90	5.98e-82	261	195	0.191	0.728	H0YD90_HUMAN Extracellular matrix receptor III (Fragment) OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=1
9	Q9Y5Y7	5.35e-15	79.0	322	0.054	0.124	LYVE1_HUMAN Lymphatic vessel endothelial hyaluronic acid receptor 1 OS=Homo sapiens OX=9606 GN=LYVE1 PE=1 SV=2
10	Q8BHC0	1.12e-13	75.1	318	0.061	0.142	LYVE1_MOUSE Lymphatic vessel endothelial hyaluronic acid receptor 1 OS=Mus musculus OX=10090 GN=Lyve1 PE=1 SV=1
11	E7F6T0	3.22e-11	68.2	392	0.046	0.087	E7F6T0_DANRE CD44 antigen OS=Danio rerio OX=7955 GN=cd44a PE=4 SV=1
12	B0BN34	9.52e-11	65.5	275	0.054	0.145	B0BN34_RAT TNF alpha induced protein 6 OS=Rattus norvegicus OX=10116 GN=Tnfaip6 PE=4 SV=1
13	O08859	9.79e-11	65.5	275	0.054	0.145	TSG6_MOUSE Tumor necrosis factor-inducible gene 6 protein OS=Mus musculus OX=10090 GN=Tnfaip6 PE=1 SV=1
14	P98066	1.08e-10	65.5	277	0.054	0.144	TSG6_HUMAN Tumor necrosis factor-inducible gene 6 protein OS=Homo sapiens OX=9606 GN=TNFAIP6 PE=1 SV=2
15	E0CZJ3	8.38e-07	55.5	2553	0.043	0.013	E0CZJ3_DANRE FEEL-1 OS=Danio rerio OX=7955 GN=FEEL-1 PE=1 SV=1
16	Q9NY15	1.30e-05	51.6	2570	0.040	0.012	STAB1_HUMAN Stabilin-1 OS=Homo sapiens OX=9606 GN=STAB1 PE=1 SV=3
17	Q75ZI3	5.52e-05	49.3	1570	0.046	0.022	Q75ZI3_DANRE Dermacan OS=Danio rerio OX=7955 GN=dcan PE=1 SV=1
18	C6GHV6	1.15e-04	48.1	2508	0.042	0.012	C6GHV6_DANRE Stabilin 2 OS=Danio rerio OX=7955 GN=si:dkey-207j16.6 PE=1 SV=1
19	F6P8Y7	1.30e-04	48.1	2543	0.042	0.012	F6P8Y7_DANRE Stabilin 2 OS=Danio rerio OX=7955 GN=si:dkey-207j16.6 PE=1 SV=1
20	P16112	1.90e-04	47.8	2530	0.038	0.011	PGCA_HUMAN Aggrecan core protein OS=Homo sapiens OX=9606 GN=ACAN PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00193 Xlink	1.6e-15	68.5	Extracellular link domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398632

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269571	0.999	Receptor tyrosine-protein kinase erbB-2
2	9606.ENSP00000377492	0.999	Hyaluronan mediated motility receptor
3	9606.ENSP00000378517	0.999	Osteopontin
4	9606.ENSP00000009530	0.998	HLA class II histocompatibility antigen gamma chain
5	9606.ENSP00000346839	0.998	Fibronectin type III domain containing
6	9606.ENSP00000275493	0.997	Epidermal growth factor receptor
7	9606.ENSP00000331736	0.997	E-selectin
8	9606.ENSP00000286827	0.996	T-lymphoma invasion and metastasis-inducing protein 1
9	9606.ENSP00000344666	0.996	Merlin
10	9606.ENSP00000356042	0.996	Ezrin
11	9606.ENSP00000361405	0.996	Matrix metalloproteinase-9
12	9606.ENSP00000268182	0.995	Ras GTPase-activating-like protein IQGAP1
13	9606.ENSP00000353408	0.995	Moesin
14	9606.ENSP00000264498	0.994	Fibroblast growth factor 2
15	9606.ENSP00000265077	0.993	Versican core protein
16	9606.ENSP00000280612	0.993	Cystine/glutamate transporter
17	9606.ENSP00000317272	0.993	Hepatocyte growth factor receptor
18	9606.ENSP00000378856	0.993	Galectin-9
19	9606.ENSP00000400175	0.993	Transforming protein RhoA
20	9606.ENSP00000337825	0.992	Tyrosine-protein kinase Lck

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005540	1.000	hyaluronic acid binding
GO:0004896	1.000	cytokine receptor activity
GO:0005102	0.515	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0009987	0.990	cellular process
GO:0080135	0.988	regulation of cellular response to stress
GO:0043066	0.988	negative regulation of apoptotic process
GO:2001242	0.987	regulation of intrinsic apoptotic signaling pathway
GO:0009968	0.987	negative regulation of signal transduction
GO:1901136	0.986	carbohydrate derivative catabolic process
GO:1901796	0.986	regulation of signal transduction by p53 class mediator
GO:0032501	0.985	multicellular organismal process
GO:0051247	0.985	positive regulation of protein metabolic process
GO:0006026	0.984	aminoglycan catabolic process
GO:0009967	0.983	positive regulation of signal transduction
GO:0030155	0.981	regulation of cell adhesion
GO:0050790	0.977	regulation of catalytic activity
GO:0001934	0.976	positive regulation of protein phosphorylation
GO:0032502	0.975	developmental process
GO:0043408	0.975	regulation of MAPK cascade
GO:0048856	0.973	anatomical structure development
GO:0030203	0.973	glycosaminoglycan metabolic process
GO:1902533	0.970	positive regulation of intracellular signal transduction
GO:2001234	0.970	negative regulation of apoptotic signaling pathway
GO:2001020	0.967	regulation of response to DNA damage stimulus
GO:1902532	0.966	negative regulation of intracellular signal transduction
GO:0043410	0.964	positive regulation of MAPK cascade
GO:2001243	0.961	negative regulation of intrinsic apoptotic signaling pathway
GO:0007275	0.960	multicellular organism development
GO:0050730	0.960	regulation of peptidyl-tyrosine phosphorylation
GO:0006027	0.960	glycosaminoglycan catabolic process
GO:2001021	0.959	negative regulation of response to DNA damage stimulus
GO:0043516	0.958	regulation of DNA damage response, signal transduction by p53 class mediator
GO:0023052	0.949	signaling
GO:1902229	0.946	regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:0006950	0.943	response to stress
GO:0007154	0.940	cell communication
GO:1901797	0.940	negative regulation of signal transduction by p53 class mediator
GO:0009888	0.938	tissue development
GO:1902253	0.938	regulation of intrinsic apoptotic signaling pathway by p53 class mediator
GO:0050731	0.929	positive regulation of peptidyl-tyrosine phosphorylation
GO:0009611	0.925	response to wounding
GO:0048731	0.924	system development
GO:1903510	0.909	mucopolysaccharide metabolic process
GO:0009892	0.906	negative regulation of metabolic process
GO:0060429	0.900	epithelium development
GO:0009653	0.874	anatomical structure morphogenesis
GO:0070372	0.863	regulation of ERK1 and ERK2 cascade
GO:0050793	0.862	regulation of developmental process
GO:0051716	0.859	cellular response to stimulus
GO:0007155	0.846	cell adhesion
GO:0051336	0.844	regulation of hydrolase activity
GO:0051128	0.843	regulation of cellular component organization
GO:0010605	0.808	negative regulation of macromolecule metabolic process
GO:0006954	0.793	inflammatory response
GO:0007165	0.792	signal transduction
GO:0070374	0.766	positive regulation of ERK1 and ERK2 cascade
GO:0098609	0.760	cell-cell adhesion
GO:0016477	0.754	cell migration
GO:2000106	0.714	regulation of leukocyte apoptotic process
GO:0002376	0.712	immune system process
GO:0042221	0.710	response to chemical
GO:0051239	0.664	regulation of multicellular organismal process
GO:0048513	0.648	animal organ development
GO:0002009	0.630	morphogenesis of an epithelium
GO:0035239	0.599	tube morphogenesis
GO:0022407	0.589	regulation of cell-cell adhesion
GO:0051172	0.534	negative regulation of nitrogen compound metabolic process
GO:0042127	0.514	regulation of cell population proliferation
GO:0010468	0.478	regulation of gene expression
GO:0042060	0.467	wound healing
GO:0007166	0.446	cell surface receptor signaling pathway
GO:1903037	0.412	regulation of leukocyte cell-cell adhesion
GO:0010033	0.409	response to organic substance
GO:0030154	0.399	cell differentiation
GO:0002682	0.323	regulation of immune system process
GO:0044237	0.315	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0098590	0.993	plasma membrane region
GO:0005622	0.963	intracellular anatomical structure
GO:0043231	0.868	intracellular membrane-bounded organelle
GO:0005737	0.854	cytoplasm
GO:0005576	0.720	extracellular region
GO:0012505	0.629	endomembrane system
GO:0120025	0.591	plasma membrane bounded cell projection
GO:0032991	0.506	protein-containing complex
GO:0005829	0.488	cytosol
GO:0016324	0.459	apical plasma membrane
GO:0030054	0.434	cell junction
GO:0005794	0.423	Golgi apparatus
GO:0070013	0.421	intracellular organelle lumen
GO:0043235	0.418	receptor complex
GO:0009986	0.409	cell surface
GO:0031982	0.368	vesicle
GO:0031252	0.367	cell leading edge
GO:0035692	0.366	macrophage migration inhibitory factor receptor complex
GO:0005925	0.366	focal adhesion
GO:0030667	0.364	secretory granule membrane
GO:0031253	0.358	cell projection membrane
GO:0031256	0.357	leading edge membrane
GO:0065010	0.347	extracellular membrane-bounded organelle
GO:0031258	0.345	lamellipodium membrane
GO:0005615	0.337	extracellular space
GO:0070062	0.321	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]