StarFunc result for job id P16104

User Input

>input (143 residues)
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TSATVGPKAPSGGKKATQASQEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZXP3	0.907	0.907	6.470E-22	143	0.986	0.986	D3ZXP3.pdb.gz	D3ZXP3_RAT Histone H2A OS=Rattus norvegicus OX=10116 GN=H2ax PE=1 SV=1
2	AFDB:Q7ZUY3	0.861	0.867	4.420E-20	142	0.881	0.887	Q7ZUY3.pdb.gz	H2AX_DANRE Histone H2AX OS=Danio rerio OX=7955 GN=h2ax PE=2 SV=3
3	AFDB:Q96QV6	0.758	0.824	1.991E-18	131	0.804	0.878	Q96QV6.pdb.gz	H2A1A_HUMAN Histone H2A type 1-A OS=Homo sapiens OX=9606 GN=H2AC1 PE=1 SV=3
4	AFDB:Q8CGP4	0.754	0.832	6.544E-18	129	0.769	0.853	Q8CGP4.pdb.gz	Q8CGP4_MOUSE Histone H2A OS=Mus musculus OX=10090 GN=H2ac1 PE=1 SV=1
5	AFDB:P04909	0.754	0.815	1.626E-16	132	0.727	0.788	P04909.pdb.gz	H2A1_SCHPO Histone H2A-alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hta1 PE=1 SV=3
6	AFDB:Q9C681	0.746	0.805	2.466E-16	132	0.692	0.750	Q9C681.pdb.gz	H2A1_ARATH Probable histone H2A.1 OS=Arabidopsis thaliana OX=3702 GN=At1g51060 PE=1 SV=1
7	AFDB:P08844	0.750	0.808	2.948E-16	132	0.755	0.818	P08844.pdb.gz	H2A_EMENI Histone H2A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=htaA PE=3 SV=2
8	AFDB:P04911	0.758	0.817	3.128E-16	132	0.650	0.705	P04911.pdb.gz	H2A1_YEAST Histone H2A.1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HTA1 PE=1 SV=2
9	AFDB:O04848	0.790	0.796	5.672E-16	142	0.678	0.683	O04848.pdb.gz	H2AXA_ARATH Probable histone H2AXa OS=Arabidopsis thaliana OX=3702 GN=At1g08880 PE=1 SV=1
10	AFDB:C6KT18	0.743	0.801	7.637E-16	132	0.650	0.705	C6KT18.pdb.gz	C6KT18_PLAF7 Histone H2A OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0617800 PE=3 SV=1
11	PDB:1id3C	0.736	0.953	7.388E-14	110	0.622	0.809	1id3C.pdb.gz	Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
12	PDB:2rvqC	0.482	0.516	3.270E-13	133	0.818	0.880	2rvqC.pdb.gz
13	PDB:7pj1A	0.432	0.492	8.269E-11	123	0.762	0.886	7pj1A.pdb.gz
14	PDB:5z30G	0.722	0.931	1.113E-10	110	0.497	0.645	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
15	PDB:6m4gC	0.592	0.919	2.299E-6	90	0.322	0.511	6m4gC.pdb.gz	Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.
16	PDB:6a7uA	0.540	0.456	3.207E-4	170	0.294	0.247	6a7uA.pdb.gz
17	PDB:5y26B	0.452	0.658	1.697E-3	92	0.105	0.163	5y26B.pdb.gz
18	PDB:7pj1B	0.438	0.501	4.951E-3	122	0.168	0.197	7pj1B.pdb.gz
19	PDB:1b67A	0.413	0.812	5.255E-3	68	0.133	0.279	1b67A.pdb.gz
20	PDB:5y27A	0.387	0.540	6.282E-3	98	0.112	0.163	5y27A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16104	2.55e-99	283	143	1.000	1.000	H2AX_HUMAN Histone H2AX OS=Homo sapiens OX=9606 GN=H2AX PE=1 SV=2
2	D3ZXP3	3.05e-98	280	143	0.986	0.986	D3ZXP3_RAT Histone H2A OS=Rattus norvegicus OX=10116 GN=H2ax PE=1 SV=1
3	P27661	1.47e-96	276	143	0.972	0.972	H2AX_MOUSE Histone H2AX OS=Mus musculus OX=10090 GN=H2ax PE=1 SV=2
4	P02264	1.16e-81	238	128	0.839	0.938	H2A_ONCMY Histone H2A OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2
5	C1BEH9	2.10e-81	237	128	0.832	0.930	C1BEH9_ONCMY Histone H2A OS=Oncorhynchus mykiss OX=8022 GN=H2A PE=2 SV=1
6	Q7ZUY3	1.55e-80	235	142	0.825	0.831	H2AX_DANRE Histone H2AX OS=Danio rerio OX=7955 GN=h2ax PE=2 SV=3
7	Q8IUE6	2.08e-80	234	130	0.825	0.908	H2A2B_HUMAN Histone H2A type 2-B OS=Homo sapiens OX=9606 GN=H2AC21 PE=1 SV=3
8	Q16777	6.87e-80	233	129	0.818	0.907	H2A2C_HUMAN Histone H2A type 2-C OS=Homo sapiens OX=9606 GN=H2AC20 PE=1 SV=4
9	Q96QV6	7.50e-80	233	131	0.804	0.878	H2A1A_HUMAN Histone H2A type 1-A OS=Homo sapiens OX=9606 GN=H2AC1 PE=1 SV=3
10	Q9BTM1	9.97e-80	233	129	0.818	0.907	H2AJ_HUMAN Histone H2A.J OS=Homo sapiens OX=9606 GN=H2AJ PE=1 SV=1
11	Q6FI13	1.28e-79	233	130	0.818	0.900	H2A2A_HUMAN Histone H2A type 2-A OS=Homo sapiens OX=9606 GN=H2AC18 PE=1 SV=3
12	Q93077	1.40e-79	233	130	0.825	0.908	H2A1C_HUMAN Histone H2A type 1-C OS=Homo sapiens OX=9606 GN=H2AC6 PE=1 SV=3
13	Q99878	1.99e-79	232	128	0.818	0.914	H2A1J_HUMAN Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3
14	Q96KK5	2.32e-79	232	128	0.818	0.914	H2A1H_HUMAN Histone H2A type 1-H OS=Homo sapiens OX=9606 GN=H2AC12 PE=1 SV=3
15	A4FTV9	2.35e-79	232	130	0.818	0.900	A4FTV9_HUMAN Histone H2A OS=Homo sapiens OX=9606 GN=HIST1H2AK PE=1 SV=1
16	P0C0S8	2.35e-79	232	130	0.818	0.900	H2A1_HUMAN Histone H2A type 1 OS=Homo sapiens OX=9606 GN=H2AC11 PE=1 SV=2
17	P70082	2.59e-79	232	129	0.811	0.899	H2AJ_CHICK Histone H2A.J OS=Gallus gallus OX=9031 GN=H2A-IX PE=3 SV=1
18	Q7L7L0	3.45e-79	231	130	0.818	0.900	H2A3_HUMAN Histone H2A type 3 OS=Homo sapiens OX=9606 GN=H2AC25 PE=1 SV=3
19	P20671	5.65e-79	231	130	0.811	0.892	H2A1D_HUMAN Histone H2A type 1-D OS=Homo sapiens OX=9606 GN=H2AC7 PE=1 SV=2
20	P04908	9.35e-79	230	130	0.811	0.892	H2A1B_HUMAN Histone H2A type 1-B/E OS=Homo sapiens OX=9606 GN=H2AC4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	0.5	22.0	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF00125 Histone	1e-11	56.6	Core histone H2A/H2B/H3/H4
3	PF16211 Histone_H2A_C	7.1e-17	72.2	C-terminus of histone H2A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010355256.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010366518.1	0.996	Mediator of DNA damage checkpoint 1
2	61622.XP_010385601.1	0.983	Belongs to the histone H2B family.
3	61622.XP_010382099.1	0.980	Tumor suppressor p53-binding protein 1
4	61622.XP_010359150.1	0.978	Serine/threonine protein kinase which activates checkpoint signaling upon double strand breaks (DSBs), apoptosis and genotoxic stresses such as ionizing ultraviolet A light (UVA), thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]- Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX at double strand breaks (DSBs), thereby regulating DNA damage response mechanism. Also plays a role in pre-B cell allelic exclusion, a process leading to expression of a single immunoglobulin heavy chain allele to enforce clonality and monospecific recognition by t [...]
5	61622.XP_010352156.1	0.970	Component of the MRE11-RAD50-NBN (MRN complex) which plays a critical role in the cellular response to DNA damage and the maintenance of chromosome integrity. The complex is involved in double- strand break (DSB) repair, DNA recombination, maintenance of telomere integrity, cell cycle checkpoint control and meiosis.
6	61622.XP_010373664.1	0.967	X-ray repair cross complementing 6
7	61622.XP_010363217.1	0.964	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 716 ESTs, 220 Proteins, and 49% coverage of the annotated genomic feature by RNAseq alignments
8	61622.XP_010372749.1	0.964	Belongs to the histone H2B family.
9	61622.XP_010375504.1	0.964	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 7 ESTs, 6 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
10	61622.XP_010383931.1	0.964	Breast cancer type 1 susceptibility protein homolog isoform X1
11	61622.XP_010363173.1	0.961	Belongs to the histone H2B family.
12	61622.XP_010372554.1	0.961	Belongs to the histone H2B family.
13	61622.XP_010388014.1	0.958	E3 ubiquitin-protein ligase that plays a key role in DNA damage signaling via 2 distinct roles: by mediating the 'Lys-63'-linked ubiquitination of histones H2A and H2AX and promoting the recruitment of DNA repair proteins at double-strand breaks (DSBs) sites, and by catalyzing 'Lys-48'-linked ubiquitination to remove target proteins from DNA damage sites. Following DNA DSBs, it is recruited to the sites of damage by ATM-phosphorylated MDC1 and catalyzes the 'Lys-63'-linked ubiquitination of histones H2A and H2AX, thereby promoting the formation of TP53BP1 and BRCA1 ionizing radiation-i [...]
14	61622.XP_010355782.1	0.955	Protein kinase, DNA-activated, catalytic polypeptide
15	61622.XP_010358863.1	0.952	Double-strand break repair protein MRE11A isoform X1
16	61622.XP_010362882.1	0.948	Uncharacterized protein LOC104663425 isoform X1
17	61622.XP_010372761.1	0.948	Uncharacterized protein LOC104671053
18	61622.XP_010372995.1	0.948	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
19	61622.XP_010363058.1	0.941	Belongs to the histone H2B family.
20	61622.XP_010372503.1	0.941	Belongs to the histone H2B family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.955	heterocyclic compound binding
GO:0097159	0.955	organic cyclic compound binding
GO:0003676	0.950	nucleic acid binding
GO:0003677	0.909	DNA binding
GO:0043565	0.490	sequence-specific DNA binding
GO:0003690	0.427	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050896	0.988	response to stimulus
GO:0006950	0.963	response to stress
GO:0071704	0.921	organic substance metabolic process
GO:0044238	0.917	primary metabolic process
GO:0050794	0.917	regulation of cellular process
GO:0006807	0.899	nitrogen compound metabolic process
GO:0043170	0.876	macromolecule metabolic process
GO:0051716	0.835	cellular response to stimulus
GO:0006974	0.822	cellular response to DNA damage stimulus
GO:0044237	0.805	cellular metabolic process
GO:0048519	0.754	negative regulation of biological process
GO:0048523	0.723	negative regulation of cellular process
GO:0019222	0.699	regulation of metabolic process
GO:0060255	0.614	regulation of macromolecule metabolic process
GO:0051171	0.512	regulation of nitrogen compound metabolic process
GO:0031323	0.497	regulation of cellular metabolic process
GO:0071840	0.489	cellular component organization or biogenesis
GO:1901360	0.474	organic cyclic compound metabolic process
GO:0046483	0.474	heterocycle metabolic process
GO:0006725	0.455	cellular aromatic compound metabolic process
GO:0034641	0.455	cellular nitrogen compound metabolic process
GO:0044260	0.454	cellular macromolecule metabolic process
GO:0090304	0.454	nucleic acid metabolic process
GO:0016043	0.434	cellular component organization
GO:0080090	0.422	regulation of primary metabolic process
GO:0023052	0.344	signaling
GO:0019219	0.339	regulation of nucleobase-containing compound metabolic process
GO:0006259	0.326	DNA metabolic process
GO:0010468	0.316	regulation of gene expression
GO:0031326	0.309	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.973	nucleoplasm
GO:0032991	0.946	protein-containing complex
GO:0043232	0.945	intracellular non-membrane-bounded organelle
GO:0005694	0.821	chromosome
GO:0005576	0.799	extracellular region
GO:0005737	0.698	cytoplasm
GO:0005615	0.551	extracellular space
GO:0070062	0.484	extracellular exosome
GO:0000785	0.357	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]