StarFunc result for job id P16109

User Input

>input (830 residues)
MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYC
QNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADN
EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGN
YTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPS
KLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVG
PEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRV
RGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGF
MLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNE
GLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFIC
DEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHF
SCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPG
TFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNL
WGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVA
STIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16109	1.000	1.000	0.000	830	1.000	1.000	P16109.pdb.gz	LYAM3_HUMAN P-selectin OS=Homo sapiens OX=9606 GN=SELP PE=1 SV=3
2	AFDB:P98106	0.343	0.369	0.000	768	0.682	0.737	P98106.pdb.gz	LYAM3_RAT P-selectin OS=Rattus norvegicus OX=10116 GN=Selp PE=2 SV=1
3	AFDB:Q01102	0.386	0.410	0.000	768	0.665	0.719	Q01102.pdb.gz	LYAM3_MOUSE P-selectin OS=Mus musculus OX=10090 GN=Selp PE=1 SV=1
4	AFDB:E5DV48	0.407	0.392	8.453E-84	868	0.395	0.378	E5DV48.pdb.gz	E5DV48_DANRE P-selectin isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-260g14.4 PE=2 SV=1
5	AFDB:P16581	0.530	0.690	1.168E-63	610	0.292	0.397	P16581.pdb.gz	LYAM2_HUMAN E-selectin OS=Homo sapiens OX=9606 GN=SELE PE=1 SV=1
6	AFDB:Q00690	0.368	0.474	5.236E-63	612	0.282	0.382	Q00690.pdb.gz	LYAM2_MOUSE E-selectin OS=Mus musculus OX=10090 GN=Sele PE=2 SV=1
7	AFDB:P98105	0.345	0.469	2.034E-55	549	0.265	0.401	P98105.pdb.gz	LYAM2_RAT E-selectin OS=Rattus norvegicus OX=10116 GN=Sele PE=2 SV=1
8	AFDB:Q9VYR4	0.237	0.180	2.685E-51	1174	0.220	0.156	Q9VYR4.pdb.gz	Q9VYR4_DROME Furrowed, isoform A OS=Drosophila melanogaster OX=7227 GN=fw PE=2 SV=2
9	AFDB:D3Z9F7	0.124	0.108	6.661E-40	1029	0.210	0.169	D3Z9F7.pdb.gz	D3Z9F7_RAT Complement C3d receptor 2 OS=Rattus norvegicus OX=10116 GN=Cr2 PE=4 SV=3
10	AFDB:P20023	0.200	0.166	1.841E-39	1033	0.199	0.160	P20023.pdb.gz	CR2_HUMAN Complement receptor type 2 OS=Homo sapiens OX=9606 GN=CR2 PE=1 SV=2
11	PDB:2gsxA	0.150	0.138	4.966E-38	951	0.180	0.157	2gsxA.pdb.gz
12	PDB:2q7zA	0.135	0.079	1.147E-34	1931	0.193	0.083	2q7zA.pdb.gz
13	PDB:1haqA	0.169	0.135	1.559E-24	1213	0.158	0.108	1haqA.pdb.gz
14	PDB:1c1zA	0.204	0.473	1.017E-19	326	0.086	0.218	1c1zA.pdb.gz
15	PDB:8a7eC	0.159	0.098	8.218E-14	1524	0.107	0.058	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:2xwbF	0.117	0.134	3.563E-10	714	0.054	0.063	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
17	PDB:8a7dQ	0.099	0.247	6.197E-9	273	0.061	0.187	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
18	PDB:7nycC	0.126	0.129	1.027E-7	809	0.060	0.062	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:3t5oA	0.119	0.114	3.281E-7	871	0.061	0.059	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
20	PDB:4e0sB	0.095	0.090	6.783E-7	898	0.069	0.063	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5DV48	0.0	612	868	0.382	0.365	E5DV48_DANRE P-selectin isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-260g14.4 PE=2 SV=1
2	P16109	0.0	1717	830	1.000	1.000	LYAM3_HUMAN P-selectin OS=Homo sapiens OX=9606 GN=SELP PE=1 SV=3
3	P98106	0.0	745	768	0.429	0.464	LYAM3_RAT P-selectin OS=Rattus norvegicus OX=10116 GN=Selp PE=2 SV=1
4	Q01102	0.0	753	768	0.433	0.467	LYAM3_MOUSE P-selectin OS=Mus musculus OX=10090 GN=Selp PE=1 SV=1
5	P16581	1.31e-166	498	610	0.289	0.393	LYAM2_HUMAN E-selectin OS=Homo sapiens OX=9606 GN=SELE PE=1 SV=1
6	Q00690	1.91e-156	472	612	0.292	0.395	LYAM2_MOUSE E-selectin OS=Mus musculus OX=10090 GN=Sele PE=2 SV=1
7	P98105	4.33e-145	440	549	0.277	0.419	LYAM2_RAT E-selectin OS=Rattus norvegicus OX=10116 GN=Sele PE=2 SV=1
8	P14151	4.46e-108	338	372	0.192	0.427	LYAM1_HUMAN L-selectin OS=Homo sapiens OX=9606 GN=SELL PE=1 SV=2
9	P18337	1.98e-106	333	372	0.195	0.435	LYAM1_MOUSE L-selectin OS=Mus musculus OX=10090 GN=Sell PE=1 SV=1
10	P30836	3.91e-101	320	372	0.195	0.435	LYAM1_RAT L-selectin OS=Rattus norvegicus OX=10116 GN=Sell PE=2 SV=1
11	P98131	3.42e-100	317	370	0.183	0.411	LYAM1_BOVIN L-selectin OS=Bos taurus OX=9913 GN=SELL PE=2 SV=1
12	Q80T79	1.12e-64	239	3707	0.199	0.045	CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus OX=10090 GN=Csmd3 PE=1 SV=3
13	A2AVA0	8.68e-62	230	3567	0.213	0.050	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
14	Q4LDE5	1.67e-59	223	3571	0.198	0.046	SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3
15	A0A1D5NSM8	8.76e-59	221	3615	0.211	0.048	A0A1D5NSM8_DANRE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing 1 OS=Danio rerio OX=7955 GN=svep1 PE=4 SV=1
16	Q96PZ7	1.01e-58	221	3564	0.195	0.045	CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CSMD1 PE=1 SV=3
17	Q9VYR4	1.78e-57	216	1174	0.258	0.182	Q9VYR4_DROME Furrowed, isoform A OS=Drosophila melanogaster OX=7227 GN=fw PE=2 SV=2
18	P91658	4.82e-56	211	974	0.239	0.203	P91658_DROME Furrowed OS=Drosophila melanogaster OX=7227 GN=fw PE=4 SV=1
19	A8JUT1	2.96e-55	206	755	0.178	0.196	A8JUT1_DROME Furrowed, isoform B OS=Drosophila melanogaster OX=7227 GN=fw PE=4 SV=1
20	Q923L3	4.77e-52	200	3564	0.200	0.047	CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus OX=10090 GN=Csmd1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	1.3	20.7	EGF-like domain
2	PF07974 EGF_2	4.1	19.2	EGF-like domain
3	PF12947 EGF_3	32	16.1	EGF domain
4	PF00059 Lectin_C	4.8e-21	86.9	Lectin C-type domain
5	PF00084 Sushi	3.4e-76	262.9	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263686

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228463	0.999	P-selectin glycoprotein ligand 1
2	9606.ENSP00000483985	0.991	Signal transducer CD24
3	9606.ENSP00000245907	0.989	Complement C3
4	9606.ENSP00000261405	0.989	Von Willebrand factor
5	9606.ENSP00000295927	0.988	Pentraxin-related protein PTX3
6	9606.ENSP00000398632	0.987	CD44 antigen
7	9606.ENSP00000329380	0.984	Platelet glycoprotein Ib alpha chain
8	9606.ENSP00000351602	0.981	Alpha-(1,3)-fucosyltransferase 4
9	9606.ENSP00000441691	0.977	Integrin alpha-M
10	9606.ENSP00000233575	0.974	Sorting nexin-17
11	9606.ENSP00000447730	0.974	CD63 antigen
12	9606.ENSP00000380948	0.969	Integrin beta-2
13	9606.ENSP00000264832	0.945	Intercellular adhesion molecule 1
14	9606.ENSP00000262407	0.937	Integrin alpha-IIb
15	9606.ENSP00000408411	0.921	Lysosome-associated membrane glycoprotein 2
16	9606.ENSP00000262094	0.908	Ras-related protein Rab-27B
17	9606.ENSP00000334145	0.890	Tissue factor
18	9606.ENSP00000294728	0.882	Vascular cell adhesion protein 1
19	9606.ENSP00000452786	0.881	Integrin beta-3
20	9606.ENSP00000457421	0.826	Platelet endothelial cell adhesion molecule

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0033691	1.000	sialic acid binding
GO:0070492	0.999	oligosaccharide binding
GO:0005539	0.998	glycosaminoglycan binding
GO:0051861	0.997	glycolipid binding
GO:1901681	0.996	sulfur compound binding
GO:0048029	0.996	monosaccharide binding
GO:0008201	0.989	heparin binding
GO:0046625	0.988	sphingolipid binding
GO:0043208	0.983	glycosphingolipid binding
GO:0042806	0.982	fucose binding
GO:0043169	0.897	cation binding
GO:0005509	0.867	calcium ion binding
GO:0001530	0.860	lipopolysaccharide binding
GO:0005102	0.335	signaling receptor binding
GO:0098772	0.311	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0048522	0.979	positive regulation of cellular process
GO:0042221	0.955	response to chemical
GO:0009605	0.944	response to external stimulus
GO:0044419	0.915	biological process involved in interspecies interaction between organisms
GO:0098609	0.904	cell-cell adhesion
GO:0009607	0.897	response to biotic stimulus
GO:0006950	0.892	response to stress
GO:0002376	0.886	immune system process
GO:0045785	0.883	positive regulation of cell adhesion
GO:0002684	0.880	positive regulation of immune system process
GO:0051716	0.869	cellular response to stimulus
GO:0006952	0.816	defense response
GO:0002685	0.807	regulation of leukocyte migration
GO:0051707	0.787	response to other organism
GO:0007154	0.757	cell communication
GO:0048583	0.751	regulation of response to stimulus
GO:0050900	0.749	leukocyte migration
GO:0023052	0.717	signaling
GO:0007165	0.713	signal transduction
GO:0007159	0.711	leukocyte cell-cell adhesion
GO:0045123	0.687	cellular extravasation
GO:0002691	0.626	regulation of cellular extravasation
GO:0098742	0.593	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0010033	0.590	response to organic substance
GO:0048584	0.515	positive regulation of response to stimulus
GO:0040017	0.501	positive regulation of locomotion
GO:0051239	0.497	regulation of multicellular organismal process
GO:0009966	0.478	regulation of signal transduction
GO:0009967	0.413	positive regulation of signal transduction
GO:0032501	0.412	multicellular organismal process
GO:1902533	0.396	positive regulation of intracellular signal transduction
GO:0051240	0.390	positive regulation of multicellular organismal process
GO:0009617	0.389	response to bacterium
GO:0032502	0.386	developmental process
GO:0030335	0.376	positive regulation of cell migration
GO:0048856	0.337	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	1.000	cell surface
GO:0005886	1.000	plasma membrane
GO:0098552	0.991	side of membrane
GO:0043227	0.989	membrane-bounded organelle
GO:0012505	0.984	endomembrane system
GO:0005622	0.979	intracellular anatomical structure
GO:0005576	0.975	extracellular region
GO:0009897	0.973	external side of plasma membrane
GO:0005737	0.971	cytoplasm
GO:0043231	0.967	intracellular membrane-bounded organelle
GO:0031982	0.895	vesicle
GO:0005615	0.887	extracellular space
GO:0031090	0.808	organelle membrane
GO:0030141	0.803	secretory granule
GO:0098588	0.657	bounding membrane of organelle
GO:0012506	0.596	vesicle membrane
GO:0030659	0.575	cytoplasmic vesicle membrane
GO:0030667	0.310	secretory granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]