StarFunc result for job id P16112

User Input

>input (2530 residues)
MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPV
TTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEV
QSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSA
IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAG
WLADRSVRYPISKARPNCGGNLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPEN
FFGVGGEEDITVQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTF
APEIGATAFAEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVF
HYRPGPTRYSLTFEEAQQACLRTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVS
PRTPCVGDKDSSPGVRTYGVRPSTETYDVYCFVDRLEGEVFFATRLEQFTFQEALEFCES
HNATLATTGQLYAAWSRGLDKCYAGWLADGSLRYPIVTPRPACGGDKPGVRTVYLYPNQT
GLPDPLSRHHAFCFRGISAVPSPGEEEGGTPTSPSGVEEWIVTQVVPGVAAVPVEEETTA
VPSGETTAILEFTTEPENQTEWEPAYTPVGTSPLPGILPTWPPTGAATEESTEGPSATEV
PSASEEPSPSEVPFPSEEPSPSEEPFPSVRPFPSVELFPSEEPFPSKEPSPSEEPSASEE
PYTPSPPVPSWTELPSSGEESGAPDVSGDFTGSGDVSGHLDFSGQLSGDRASGLPSGDLD
SSGLTSTVGSGLPVESGLPSGDEERIEWPSTPTVGELPSGAEILEGSASGVGDLSGLPSG
EVLETSASGVGDLSGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVL
ETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETT
APGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPG
VEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVED
ISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISG
LPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPS
GEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEV
LETAAPGVEDISGLPSGEVLETTAPGVEEISGLPSGEVLETTAPGVDEISGLPSGEVLET
TAPGVEEISGLPSGEVLETSTSAVGDLSGLPSGGEVLEISVSGVEDISGLPSGEVVETSA
SGIEDVSELPSGEGLETSASGVEDLSRLPSGEEVLEISASGFGDLSGLPSGGEGLETSAS
EVGTDLSGLPSGREGLETSASGAEDLSGLPSGKEDLVGSASGDLDLGKLPSGTLGSGQAP
ETSGLPSGFSGEYSGVDLGSGPPSGLPDFSGLPSGFPTVSLVDSTLVEVVTASTASELEG
RGTIGISGAGEISGLPSSELDISGRASGLPSGTELSGQASGSPDVSGEIPGLFGVSGQPS
GFPDTSGETSGVTELSGLSSGQPGISGEASGVLYGTSQPFGITDLSGETSGVPDLSGQPS
GLPGFSGATSGVPDLVSGTTSGSGESSGITFVDTSLVEVAPTTFKEEEGLGSVELSGLPS
GEADLSGKSGMVDVSGQFSGTVDSSGFTSQTPEFSGLPSGIAEVSGESSRAEIGSSLPSG
AYYGSGTPSSFPTVSLVDRTLVESVTQAPTAQEAGEGPSGILELSGAHSGAPDMSGEHSG
FLDLSGLQSGLIEPSGEPPGTPYFSGDFASTTNVSGESSVAMGTSGEASGLPEVTLITSE
FVEGVTEPTISQELGQRPPVTHTPQLFESSGKVSTAGDISGATPVLPGSGVEVSSVPESS
SETSAYPEAGFGASAAPEASREDSGSPDLSETTSAFHEANLERSSGLGVSGSTLTFQEGE
ASAAPEVSGESTTTSDVGTEAPGLPSATPTASGDRTEISGDLSGHTSQLGVVISTSIPES
EWTQQTQRPAETHLEIESSSLLYSGEETHTVETATSPTDASIPASPEWKRESESTAAAPA
RSCAEEPCGAGTCKETEGHVICLCPPGYTGEHCNIDQEVCEEGWNKYQGHCYRHFPDRET
WVDAERRCREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTIEGDFRWSDGHPMQFEN
WRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTVACGEPPVVEHARTFG
QKKDRYEINSLVRYQCTEGFVQRHMPTIRCQPSGHWEEPQITCTDPTTYKRRLQKRSSRH
PRRSRPSTAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13608	0.232	0.246	0.000	2364	0.721	0.772	P13608.pdb.gz	PGCA_BOVIN Aggrecan core protein OS=Bos taurus OX=9913 GN=ACAN PE=1 SV=3
2	AFDB:P16112	1.000	1.000	0.000	2530	1.000	1.000	P16112.pdb.gz	PGCA_HUMAN Aggrecan core protein OS=Homo sapiens OX=9606 GN=ACAN PE=1 SV=3
3	AFDB:Q61282	0.222	0.259	0.000	2132	0.643	0.764	Q61282.pdb.gz	PGCA_MOUSE Aggrecan core protein OS=Mus musculus OX=10090 GN=Acan PE=1 SV=2
4	AFDB:F1QDA1	0.204	0.319	5.452E-81	1547	0.290	0.474	F1QDA1.pdb.gz	F1QDA1_DANRE Aggrecan a OS=Danio rerio OX=7955 GN=acana PE=4 SV=2
5	AFDB:F8W252	0.162	0.276	2.122E-76	1373	0.264	0.486	F8W252.pdb.gz
6	AFDB:A0A2R8QK78	0.205	0.318	2.538E-47	1570	0.194	0.313	A0A2R8QK78.pdb.gz
7	AFDB:P55066	0.128	0.251	9.912E-40	1268	0.183	0.365	P55066.pdb.gz	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
8	AFDB:Q86W61	0.126	0.837	3.205E-31	354	0.070	0.497	Q86W61.pdb.gz	Q86W61_HUMAN VCAN protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=1
9	AFDB:A0A2R8Q3K1	0.122	0.466	5.437E-31	635	0.076	0.302	A0A2R8Q3K1.pdb.gz	A0A2R8Q3K1_DANRE Chondroitin sulfate proteoglycan 2 OS=Danio rerio OX=7955 GN=br146 PE=4 SV=1
10	PDB:1qddA	0.048	0.795	2.559E-8	144	0.017	0.306	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
11	PDB:4mthA	0.047	0.773	3.452E-7	139	0.016	0.288	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
12	PDB:7wz8A	0.047	0.623	5.398E-7	180	0.017	0.244	7wz8A.pdb.gz
13	PDB:5f2qB	0.047	0.792	6.889E-7	135	0.016	0.296	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
14	PDB:3bx4C	0.040	0.656	2.977E-6	134	0.016	0.306	3bx4C.pdb.gz
15	PDB:1bj3A	0.039	0.678	3.502E-6	129	0.018	0.349	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
16	PDB:1htnA	0.046	0.700	4.848E-6	156	0.013	0.212	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
17	PDB:1gz2A	0.047	0.781	1.186E-5	139	0.015	0.266	1gz2A.pdb.gz
18	PDB:3oaiA	0.040	0.198	1.513E-5	488	0.007	0.035	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
19	PDB:7qsrA	0.047	0.089	1.576E-5	1335	0.019	0.035	7qsrA.pdb.gz
20	AFDB:Q5H9R4	0.030	0.031	1.347E-4	2290	0.119	0.132	Q5H9R4.pdb.gz	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F537	0.0	756	1509	0.149	0.250	E7F537_DANRE Aggrecan a OS=Danio rerio OX=7955 GN=acana PE=4 SV=3
2	F1QDA1	0.0	756	1547	0.149	0.244	F1QDA1_DANRE Aggrecan a OS=Danio rerio OX=7955 GN=acana PE=4 SV=2
3	P07897	0.0	1524	2124	0.361	0.430	PGCA_RAT Aggrecan core protein OS=Rattus norvegicus OX=10116 GN=Acan PE=1 SV=2
4	P13608	0.0	1806	2364	0.422	0.452	PGCA_BOVIN Aggrecan core protein OS=Bos taurus OX=9913 GN=ACAN PE=1 SV=3
5	P16112	0.0	4936	2530	1.000	1.000	PGCA_HUMAN Aggrecan core protein OS=Homo sapiens OX=9606 GN=ACAN PE=1 SV=3
6	Q29011	0.0	877	537	0.164	0.773	PGCA_PIG Aggrecan core protein (Fragments) OS=Sus scrofa OX=9823 GN=ACAN PE=1 SV=3
7	Q61282	0.0	1544	2132	0.363	0.431	PGCA_MOUSE Aggrecan core protein OS=Mus musculus OX=10090 GN=Acan PE=1 SV=2
8	Q86W61	5.82e-112	363	354	0.070	0.503	Q86W61_HUMAN VCAN protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=1
9	Q96GW7	7.04e-107	368	911	0.077	0.213	PGCB_HUMAN Brevican core protein OS=Homo sapiens OX=9606 GN=BCAN PE=1 SV=2
10	P13611	2.34e-104	379	3396	0.070	0.052	CSPG2_HUMAN Versican core protein OS=Homo sapiens OX=9606 GN=VCAN PE=1 SV=3
11	A0A2R8Q3K1	4.65e-103	348	635	0.056	0.224	A0A2R8Q3K1_DANRE Chondroitin sulfate proteoglycan 2 OS=Danio rerio OX=7955 GN=br146 PE=4 SV=1
12	Q9ERB4	4.66e-103	374	2738	0.070	0.065	CSPG2_RAT Versican core protein (Fragments) OS=Rattus norvegicus OX=10116 GN=Vcan PE=2 SV=2
13	P55068	7.72e-103	355	883	0.072	0.207	PGCB_RAT Brevican core protein OS=Rattus norvegicus OX=10116 GN=Bcan PE=1 SV=2
14	Q61361	6.21e-102	352	883	0.072	0.205	PGCB_MOUSE Brevican core protein OS=Mus musculus OX=10090 GN=Bcan PE=1 SV=2
15	Q62059	8.45e-101	367	3357	0.069	0.052	CSPG2_MOUSE Versican core protein OS=Mus musculus OX=10090 GN=Vcan PE=1 SV=2
16	A4JYN2	1.17e-100	358	1295	0.070	0.137	A4JYN2_DANRE Bcan OS=Danio rerio OX=7955 GN=fi32a12 PE=1 SV=1
17	F1SX59	7.16e-100	364	3382	0.072	0.054	F1SX59_PIG Versican OS=Sus scrofa OX=9823 GN=VCAN PE=2 SV=1
18	Q75ZI3	8.97e-98	353	1570	0.055	0.088	Q75ZI3_DANRE Dermacan OS=Danio rerio OX=7955 GN=dcan PE=1 SV=1
19	O14594	4.79e-96	344	1321	0.064	0.122	NCAN_HUMAN Neurocan core protein OS=Homo sapiens OX=9606 GN=NCAN PE=1 SV=3
20	P55067	8.28e-96	342	1257	0.064	0.129	NCAN_RAT Neurocan core protein OS=Rattus norvegicus OX=10116 GN=Ncan PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16839 Antimicrobial25	5.6e+02	12.0	Nematode antimicrobial peptide
2	PF00008 EGF	0.36	22.5	EGF-like domain
3	PF07974 EGF_2	15	17.3	EGF-like domain
4	PF07679 I-set	32	16.0	Immunoglobulin I-set domain
5	PF00047 ig	38	15.9	Immunoglobulin domain
6	PF13927 Ig_3	3e+02	13.4	Immunoglobulin domain
7	PF00059 Lectin_C	8.6e-19	79.6	Lectin C-type domain
8	PF00084 Sushi	8.5e-06	37.5	Sushi repeat (SCR repeat)
9	PF07686 V-set	4e-07	41.6	Immunoglobulin V-set domain
10	PF00193 Xlink	3e-124	417.0	Extracellular link domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387356

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356975	0.995	A disintegrin and metalloproteinase with thrombospondin motifs 4
2	9606.ENSP00000284987	0.991	A disintegrin and metalloproteinase with thrombospondin motifs 5
3	9606.ENSP00000346839	0.989	Fibronectin type III domain containing
4	9606.ENSP00000260302	0.988	Collagenase 3
5	9606.ENSP00000299855	0.986	Stromelysin-1
6	9606.ENSP00000266718	0.983	Lumican
7	9606.ENSP00000284984	0.981	A disintegrin and metalloproteinase with thrombospondin motifs 1
8	9606.ENSP00000347041	0.981	Fibromodulin
9	9606.ENSP00000356646	0.980	Tenascin-R
10	9606.ENSP00000322788	0.974	Interstitial collagenase
11	9606.ENSP00000219070	0.967	72 kDa type IV collagenase
12	9606.ENSP00000361405	0.965	Matrix metalloproteinase-9
13	9606.ENSP00000260227	0.963	Matrilysin
14	9606.ENSP00000362870	0.961	Cartilage matrix protein
15	9606.ENSP00000222271	0.956	Cartilage oligomeric matrix protein
16	9606.ENSP00000418735	0.956	A disintegrin and metalloproteinase with thrombospondin motifs 9
17	9606.ENSP00000343924	0.953	Prolargin
18	9606.ENSP00000257359	0.951	A disintegrin and metalloproteinase with thrombospondin motifs 8
19	9606.ENSP00000265131	0.949	Tenascin
20	9606.ENSP00000364700	0.944	Osteomodulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	0.923	extracellular matrix structural constituent
GO:0005102	0.314	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0032502	0.985	developmental process
GO:0048856	0.982	anatomical structure development
GO:0007275	0.960	multicellular organism development
GO:0051216	0.916	cartilage development
GO:0048869	0.877	cellular developmental process
GO:0050896	0.876	response to stimulus
GO:0030154	0.874	cell differentiation
GO:0071704	0.835	organic substance metabolic process
GO:0065007	0.830	biological regulation
GO:0016043	0.827	cellular component organization
GO:0050794	0.815	regulation of cellular process
GO:0009653	0.767	anatomical structure morphogenesis
GO:0044238	0.599	primary metabolic process
GO:0006807	0.555	nitrogen compound metabolic process
GO:0043170	0.519	macromolecule metabolic process
GO:1901564	0.466	organonitrogen compound metabolic process
GO:0044237	0.454	cellular metabolic process
GO:0019538	0.441	protein metabolic process
GO:0048519	0.400	negative regulation of biological process
GO:0048523	0.370	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0071944	0.997	cell periphery
GO:0043226	0.993	organelle
GO:0031974	0.989	membrane-enclosed lumen
GO:0070013	0.981	intracellular organelle lumen
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0062023	0.976	collagen-containing extracellular matrix
GO:0012505	0.973	endomembrane system
GO:0005737	0.972	cytoplasm
GO:0005615	0.867	extracellular space
GO:0005794	0.828	Golgi apparatus
GO:0043202	0.738	lysosomal lumen
GO:0005796	0.698	Golgi lumen
GO:0016020	0.531	membrane
GO:0005886	0.302	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]