StarFunc result for job id P16118

User Input

>input (471 residues)
MSPEMGELTQTRLQKIWIPHSSGSSRLQRRRGSSIPQFTNSPTMVIMVGLPARGKTYIST
KLTRYLNWIGTPTKVFNLGQYRREAVSYKNYEFFLPDNMEALQIRKQCALAALKDVHNYL
SHEEGHVAVFDATNTTRERRSLILQFAKEHGYKVFFIESICNDPGIIAENIRQVKLGSPD
YIDCDREKVLEDFLKRIECYEVNYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHIQSRT
VYYLMNIHVTPRSIYLCRHGESELNIRGRIGGDSGLSVRGKQYAYALANFIQSQGISSLK
VWTSHMKRTIQTAEALGVPYEQWKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRY
RYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLH
TVLKLTPVAYGCKVESIYLNVEAVNTHREKPENVDITREPEEALDTVPAHY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P07953	0.994	0.994	3.155E-94	471	0.953	0.953	P07953.pdb.gz	F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus OX=10116 GN=Pfkfb1 PE=1 SV=3
2	AFDB:Q91348	0.974	0.977	1.052E-83	470	0.792	0.794	Q91348.pdb.gz	F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus OX=9031 PE=2 SV=2
3	PDB:1k6mA	0.912	0.994	1.427E-82	432	0.907	0.988	1k6mA.pdb.gz	Tissue-specific structure/function differentiation of the liver isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.
4	AFDB:P25114	0.974	0.979	3.918E-82	469	0.743	0.746	P25114.pdb.gz	F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus OX=10116 GN=Pfkfb4 PE=1 SV=3
5	AFDB:A0A1W2PR17	0.937	0.778	5.306E-75	568	0.684	0.567	A0A1W2PR17.pdb.gz	A0A1W2PR17_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
6	AFDB:O35552	0.929	0.789	4.192E-74	555	0.679	0.577	O35552.pdb.gz	F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus OX=10116 GN=Pfkfb3 PE=2 SV=1
7	PDB:1bifA	0.903	0.984	1.132E-72	432	0.707	0.771	1bifA.pdb.gz	The crystal structure of the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase reveals distinct domain homologies.
8	AFDB:Q9JJH5	0.885	0.750	1.165E-71	557	0.669	0.566	Q9JJH5.pdb.gz	F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus OX=10116 GN=Pfkfb2 PE=1 SV=1
9	PDB:2axnA	0.915	0.955	4.217E-71	451	0.677	0.707	2axnA.pdb.gz	Crystal structure of the hypoxia-inducible form of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3): a possible new target for cancer therapy.
10	PDB:5htkA	0.847	0.936	8.155E-66	425	0.658	0.729	5htkA.pdb.gz	Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
11	AFDB:Q9N590	0.870	0.910	7.689E-60	450	0.514	0.538	Q9N590.pdb.gz	Q9N590_CAEEL 6-phosphofructo-2-kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pfkb-1.1 PE=1 SV=2
12	AFDB:P32604	0.864	0.899	2.962E-54	452	0.429	0.447	P32604.pdb.gz	F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FBP26 PE=1 SV=2
13	AFDB:Q9MB58	0.818	0.525	1.601E-47	744	0.403	0.255	Q9MB58.pdb.gz	F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana OX=3702 GN=FKFBP PE=1 SV=1
14	AFDB:P40433	0.796	0.459	5.960E-46	827	0.386	0.220	P40433.pdb.gz	6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFK26 PE=1 SV=1
15	PDB:1e58A	0.346	0.630	1.487E-11	247	0.119	0.227	1e58A.pdb.gz
16	PDB:2h4zA	0.335	0.592	1.766E-11	255	0.108	0.200	2h4zA.pdb.gz	Seeing the process of histidine phosphorylation in human bisphosphoglycerate mutase.
17	PDB:6s2rA	0.359	0.684	2.222E-11	234	0.096	0.192	6s2rA.pdb.gz
18	PDB:4embA	0.356	0.660	6.247E-11	245	0.104	0.200	4embA.pdb.gz
19	PDB:1riiA	0.336	0.624	8.324E-11	243	0.113	0.218	1riiA.pdb.gz
20	PDB:1qhfA	0.347	0.645	8.816E-11	240	0.110	0.217	1qhfA.pdb.gz	Structure of a phosphoglycerate mutase:3-phosphoglyceric acid complex at 1.7 A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1W2PR17	0.0	687	568	0.682	0.565	A0A1W2PR17_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
2	F2Z2I2	0.0	687	455	0.684	0.708	F2Z2I2_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
3	O35552	0.0	692	555	0.684	0.580	F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus OX=10116 GN=Pfkfb3 PE=2 SV=1
4	O60825	0.0	671	505	0.662	0.618	F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=2
5	P07953	0.0	942	471	0.953	0.953	F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus OX=10116 GN=Pfkfb1 PE=1 SV=3
6	P16118	0.0	984	471	1.000	1.000	F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens OX=9606 GN=PFKFB1 PE=1 SV=3
7	P25114	0.0	738	469	0.747	0.751	F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus OX=10116 GN=Pfkfb4 PE=1 SV=3
8	P70265	0.0	660	519	0.658	0.597	F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus OX=10090 GN=Pfkfb2 PE=1 SV=2
9	Q16875	0.0	689	520	0.682	0.617	F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
10	Q16877	0.0	743	469	0.749	0.753	F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens OX=9606 GN=PFKFB4 PE=1 SV=6
11	Q28901	0.0	668	463	0.671	0.683	F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus OX=9913 GN=PFKFB3 PE=1 SV=2
12	Q5VX20	0.0	687	526	0.682	0.610	Q5VX20_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
13	Q5W015	0.0	687	513	0.682	0.626	Q5W015_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1
14	Q91348	0.0	786	470	0.796	0.798	F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus OX=9031 PE=2 SV=2
15	Q9JJH5	0.0	663	557	0.660	0.558	F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus OX=10116 GN=Pfkfb2 PE=1 SV=1
16	Q9N590	2.96e-171	491	450	0.514	0.538	Q9N590_CAEEL 6-phosphofructo-2-kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pfkb-1.1 PE=1 SV=2
17	P32604	7.60e-139	408	452	0.429	0.447	F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FBP26 PE=1 SV=2
18	Q9MB58	7.10e-115	356	744	0.393	0.249	F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana OX=3702 GN=FKFBP PE=1 SV=1
19	P40433	1.25e-94	305	827	0.418	0.238	6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFK26 PE=1 SV=1
20	Q9UTE1	2.99e-83	270	592	0.323	0.257	YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC222.13c PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01591 6PF2K	1.3e-100	346.8	6-phosphofructo-2-kinase
2	PF13671 AAA_33	0.00026	32.6	AAA domain
3	PF00300 His_Phos_1	1.7e-37	140.5	Histidine phosphatase superfamily (branch 1)
4	PF08433 KTI12	21	16.1	Chromatin associated protein KTI12
5	PF06414 Zeta_toxin	4.1	18.2	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364145

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309591	0.965	cAMP-dependent protein kinase catalytic subunit alpha
2	9606.ENSP00000359719	0.954	cAMP-dependent protein kinase catalytic subunit beta
3	9606.ENSP00000366488	0.954	cAMP-dependent protein kinase catalytic subunit gamma
4	9606.ENSP00000179259	0.952	Fructose-2,6-bisphosphatase TIGAR
5	9606.ENSP00000443319	0.926	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
6	9606.ENSP00000232375	0.922	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4
7	9606.ENSP00000345771	0.917	ATP-dependent 6-phosphofructokinase, muscle type
8	9606.ENSP00000417963	0.913	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
9	9606.ENSP00000221138	0.912	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
10	9606.ENSP00000311344	0.908	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
11	9606.ENSP00000318318	0.908	Mannose-6-phosphate isomerase
12	9606.ENSP00000418447	0.908	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
13	9606.ENSP00000324804	0.904	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
14	9606.ENSP00000356047	0.903	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
15	9606.ENSP00000269848	0.858	ATP-dependent 6-phosphofructokinase, liver type
16	9606.ENSP00000370517	0.843	ATP-dependent 6-phosphofructokinase, platelet type
17	9606.ENSP00000364486	0.819	Fructose-1,6-bisphosphatase isozyme 2
18	9606.ENSP00000408025	0.808	Fructose-1,6-bisphosphatase 1
19	9606.ENSP00000290573	0.785	Hexokinase-2
20	9606.ENSP00000379701	0.764	Hepatocyte nuclear factor 4-gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0050308	0.999	sugar-phosphatase activity
GO:0008443	0.999	phosphofructokinase activity
GO:0004331	0.983	fructose-2,6-bisphosphate 2-phosphatase activity
GO:0003873	0.981	6-phosphofructo-2-kinase activity
GO:0042802	0.890	identical protein binding
GO:0019899	0.850	enzyme binding
GO:0019900	0.412	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006793	0.993	phosphorus metabolic process
GO:1901135	0.987	carbohydrate derivative metabolic process
GO:0006796	0.980	phosphate-containing compound metabolic process
GO:0019637	0.968	organophosphate metabolic process
GO:0005975	0.966	carbohydrate metabolic process
GO:0044281	0.903	small molecule metabolic process
GO:0016310	0.894	phosphorylation
GO:0006807	0.833	nitrogen compound metabolic process
GO:0050789	0.681	regulation of biological process
GO:0019752	0.578	carboxylic acid metabolic process
GO:0019222	0.544	regulation of metabolic process
GO:0019318	0.535	hexose metabolic process
GO:1901564	0.533	organonitrogen compound metabolic process
GO:0050794	0.528	regulation of cellular process
GO:0080090	0.499	regulation of primary metabolic process
GO:0031323	0.485	regulation of cellular metabolic process
GO:0032787	0.481	monocarboxylic acid metabolic process
GO:0006090	0.451	pyruvate metabolic process
GO:0034641	0.416	cellular nitrogen compound metabolic process
GO:1901360	0.415	organic cyclic compound metabolic process
GO:0046483	0.411	heterocycle metabolic process
GO:0006725	0.407	cellular aromatic compound metabolic process
GO:0016052	0.384	carbohydrate catabolic process
GO:0050896	0.368	response to stimulus
GO:0006139	0.364	nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:1902494	0.919	catalytic complex
GO:0070013	0.886	intracellular organelle lumen
GO:0043231	0.874	intracellular membrane-bounded organelle
GO:0005634	0.844	nucleus
GO:1990234	0.775	transferase complex
GO:0061695	0.758	transferase complex, transferring phosphorus-containing groups
GO:0031981	0.683	nuclear lumen
GO:0005654	0.658	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.
EC:3.1.3.23	0.999	sugar-phosphatase.
RHEA:17289	0.983	beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate
EC:3.1.3.46	0.983	fructose-2,6-bisphosphate 2-phosphatase.
RHEA:15653	0.981	ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+)
EC:2.7.1.105	0.981	6-phosphofructo-2-kinase.

[back to server]