StarFunc result for job id P16144

User Input

>input (1822 residues)
MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRR
CNTQAELLAAGCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFEL
EVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDERCHLDTTGTYTQYR
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTRTGSFHIRRGEVGIYQVQLRALEHVDG
THVCQLPEDQKGNIHLKPSFSDGLKMDAGIICDVCTCELQKEVRSARCSFNGDFVCGQCV
CSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDN
FQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGR
CHCHQQSLYTDTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDE
LKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGSFWWLIPLLLL
LLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPMLR
SGNLKGRDVVRWKVTNNMQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTREC
AQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLK
LTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQL
LVEAIDVPAGTATLGRRLVNITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVLDGG
KSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQVRRFH
VQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQPPPHGDLGAPQNPNAKAAGS
RKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYG
AQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV
NDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQP
KRPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTGCGWKFEPLLG
EELDLRRVTWRLPPELIPRLSASSGRSSDAEAPHGPPDDGGAGGKGGSLPRSATPGPPGE
HLVNGRMDFAFPGSTNSLHRMTTTSAAAYGTHLSPHVPHRVLSTSSTLTRDYNSLTRSEH
SHSTTLPRDYSTLTSVSSHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGY
SVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIES
QVHPQSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEM
AQGGGPATAFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGG
PFPQLGSRAGLFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEF
VSRTLTTSGTLSTHMDQQFFQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A863	0.729	0.731	0.000	1818	0.881	0.883	A2A863.pdb.gz	ITB4_MOUSE Integrin beta-4 OS=Mus musculus OX=10090 GN=Itgb4 PE=1 SV=1
2	AFDB:P16144	1.000	1.000	0.000	1822	1.000	1.000	P16144.pdb.gz	ITB4_HUMAN Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4 PE=1 SV=5
3	AFDB:P49134	0.244	0.521	5.759E-71	799	0.147	0.335	P49134.pdb.gz	ITB1_RAT Integrin beta-1 OS=Rattus norvegicus OX=10116 GN=Itgb1 PE=2 SV=1
4	AFDB:P11584	0.253	0.519	8.291E-69	846	0.136	0.293	P11584.pdb.gz	ITBX_DROME Integrin beta-PS OS=Drosophila melanogaster OX=7227 GN=mys PE=1 SV=3
5	PDB:4g1eB	0.288	0.648	6.951E-66	709	0.139	0.357	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
6	AFDB:E7FCN5	0.237	0.522	9.111E-65	768	0.133	0.316	E7FCN5.pdb.gz	E7FCN5_DANRE Integrin beta OS=Danio rerio OX=7955 GN=itgb2 PE=1 SV=1
7	AFDB:Q27591	0.226	0.481	3.561E-60	799	0.117	0.267	Q27591.pdb.gz	ITBN_DROME Integrin beta-nu OS=Drosophila melanogaster OX=7227 GN=Itgbn PE=1 SV=2
8	PDB:7nxdB	0.241	0.587	2.916E-58	690	0.138	0.364	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
9	PDB:5es4B	0.281	0.639	3.777E-56	674	0.128	0.346	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
10	AFDB:P26012	0.228	0.520	4.225E-55	769	0.119	0.281	P26012.pdb.gz	ITB8_HUMAN Integrin beta-8 OS=Homo sapiens OX=9606 GN=ITGB8 PE=1 SV=1
11	PDB:1u8cB	0.251	0.656	3.892E-48	599	0.111	0.339	1u8cB.pdb.gz	A novel adaptation of the integrin PSI domain revealed from its crystal structure.
12	AFDB:P23468	0.100	0.095	4.903E-33	1912	0.071	0.068	P23468.pdb.gz	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2
13	PDB:6ujaB	0.184	0.888	2.079E-32	359	0.060	0.306	6ujaB.pdb.gz	Cryo-EM Reveals Integrin-Mediated TGF-beta Activation without Release from Latent TGF-beta.
14	AFDB:O97394	0.099	0.082	2.525E-32	2224	0.092	0.075	O97394.pdb.gz	SDK_DROME Protein sidekick OS=Drosophila melanogaster OX=7227 GN=sdk PE=1 SV=2
15	AFDB:P43146	0.100	0.125	3.289E-32	1447	0.082	0.103	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
16	PDB:7q5zA	0.069	0.087	6.321E-14	1344	0.043	0.059	7q5zA.pdb.gz
17	PDB:6pxvA	0.087	0.178	1.820E-13	823	0.032	0.072	6pxvA.pdb.gz
18	PDB:8eyyA	0.092	0.209	3.814E-13	775	0.035	0.081	8eyyA.pdb.gz
19	PDB:6pyhD	0.083	0.174	4.240E-13	798	0.033	0.076	6pyhD.pdb.gz
20	PDB:1e07A	0.064	0.151	4.470E-13	642	0.041	0.115	1e07A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A863	0.0	3251	1818	0.879	0.881	ITB4_MOUSE Integrin beta-4 OS=Mus musculus OX=10090 GN=Itgb4 PE=1 SV=1
2	P16144	0.0	3776	1822	1.000	1.000	ITB4_HUMAN Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4 PE=1 SV=5
3	Q64632	0.0	3033	1807	0.834	0.841	ITB4_RAT Integrin beta-4 OS=Rattus norvegicus OX=10116 GN=Itgb4 PE=1 SV=1
4	Q27874	5.19e-135	443	809	0.145	0.326	PAT3_CAEEL Integrin beta pat-3 OS=Caenorhabditis elegans OX=6239 GN=pat-3 PE=1 SV=1
5	Q3YAA0	3.00e-130	429	795	0.149	0.342	Q3YAA0_DANRE Integrin beta OS=Danio rerio OX=7955 GN=itgb1 PE=1 SV=1
6	P09055	4.15e-129	426	798	0.153	0.350	ITB1_MOUSE Integrin beta-1 OS=Mus musculus OX=10090 GN=Itgb1 PE=1 SV=1
7	F1QG85	1.89e-127	422	798	0.150	0.343	F1QG85_DANRE Integrin beta OS=Danio rerio OX=7955 GN=itgb1 PE=1 SV=1
8	O54890	2.81e-127	421	787	0.143	0.332	ITB3_MOUSE Integrin beta-3 OS=Mus musculus OX=10090 GN=Itgb3 PE=1 SV=2
9	Q3YAA1	3.22e-127	421	798	0.150	0.343	Q3YAA1_DANRE Integrin beta OS=Danio rerio OX=7955 GN=itgb1 PE=1 SV=1
10	P05556	5.66e-127	421	798	0.149	0.341	ITB1_HUMAN Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2
11	Q8R2H2	4.37e-126	418	787	0.143	0.330	ITB3_RAT Integrin beta-3 OS=Rattus norvegicus OX=10116 GN=Itgb3 PE=1 SV=1
12	P49134	4.04e-125	415	799	0.151	0.345	ITB1_RAT Integrin beta-1 OS=Rattus norvegicus OX=10116 GN=Itgb1 PE=2 SV=1
13	L7RT22	5.99e-125	415	799	0.146	0.333	L7RT22_HUMAN Integrin beta OS=Homo sapiens OX=9606 GN=ITGB5 PE=1 SV=1
14	P18084	5.99e-125	415	799	0.146	0.333	ITB5_HUMAN Integrin beta-5 OS=Homo sapiens OX=9606 GN=ITGB5 PE=1 SV=1
15	P18564	2.04e-124	413	788	0.141	0.325	ITB6_HUMAN Integrin beta-6 OS=Homo sapiens OX=9606 GN=ITGB6 PE=1 SV=2
16	O70309	2.08e-124	413	798	0.147	0.336	ITB5_MOUSE Integrin beta-5 OS=Mus musculus OX=10090 GN=Itgb5 PE=1 SV=2
17	A0A8I5ZKE8	3.01e-124	413	799	0.148	0.338	A0A8I5ZKE8_RAT Integrin beta OS=Rattus norvegicus OX=10116 GN=Itgb5 PE=1 SV=1
18	P07228	4.24e-124	412	803	0.149	0.339	ITB1_CHICK Integrin beta-1 OS=Gallus gallus OX=9031 GN=ITGB1 PE=1 SV=1
19	Q3LTM5	5.69e-124	412	790	0.141	0.324	Q3LTM5_DANRE Integrin beta OS=Danio rerio OX=7955 GN=itgb3.1 PE=2 SV=1
20	Q9Z0T9	8.19e-124	411	787	0.136	0.315	ITB6_MOUSE Integrin beta-6 OS=Mus musculus OX=10090 GN=Itgb6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03160 Calx-beta	1.3e-20	84.7	Calx-beta domain
2	PF07974 EGF_2	0.0025	29.4	EGF-like domain
3	PF00041 fn3	1.4e-69	241.7	Fibronectin type III domain
4	PF18372 I-EGF_1	4.8e-08	44.1	Integrin beta epidermal growth factor like domain 1
5	PF00362 Integrin_beta	2.4e-101	350.2	Integrin beta chain VWA domain
6	PF07965 Integrin_B_tail	2.2e-14	65.0	Integrin beta tail domain
7	PF17205 PSI_integrin	3.5e-07	41.1	Integrin plexin domain
8	PF16656 Pur_ac_phosph_N	0.00042	32.2	Purple acid Phosphatase, N-terminal domain
9	PF01390 SEA	1.3e+02	14.1	SEA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000200181

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323856	0.999	Plectin
2	9606.ENSP00000386896	0.999	Integrin alpha-6
3	9606.ENSP00000340937	0.998	Collagen alpha-1(XVII) chain
4	9606.ENSP00000275493	0.983	Epidermal growth factor receptor
5	9606.ENSP00000375778	0.982	Laminin subunit beta-3
6	9606.ENSP00000401303	0.978	SHC-transforming protein 1
7	9606.ENSP00000324532	0.972	Laminin subunit alpha-3
8	9606.ENSP00000007722	0.967	Integrin alpha-3
9	9606.ENSP00000252999	0.966	Laminin subunit alpha-5
10	9606.ENSP00000317272	0.963	Hepatocyte growth factor receptor
11	9606.ENSP00000264144	0.962	Laminin subunit gamma-2
12	9606.ENSP00000230538	0.960	Laminin subunit alpha-4
13	9606.ENSP00000341189	0.959	Focal adhesion kinase 1
14	9606.ENSP00000222399	0.957	Laminin subunit beta-1
15	9606.ENSP00000376345	0.955	Growth factor receptor-bound protein 2
16	9606.ENSP00000258341	0.953	Laminin subunit gamma-1
17	9606.ENSP00000265171	0.953	Pro-epidermal growth factor
18	9606.ENSP00000307959	0.952	Dystonin
19	9606.ENSP00000261769	0.951	Cadherin-1
20	9606.ENSP00000362680	0.943	Proto-oncogene tyrosine-protein kinase Src

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.984	signaling receptor binding
GO:0019838	0.938	growth factor binding
GO:0031994	0.933	insulin-like growth factor I binding
GO:0001664	0.587	G protein-coupled receptor binding
GO:0038132	0.474	neuregulin binding
GO:0050839	0.303	cell adhesion molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0048856	0.991	anatomical structure development
GO:0032501	0.989	multicellular organismal process
GO:0050896	0.985	response to stimulus
GO:0050794	0.968	regulation of cellular process
GO:0007275	0.947	multicellular organism development
GO:0007155	0.939	cell adhesion
GO:0071840	0.927	cellular component organization or biogenesis
GO:0009653	0.925	anatomical structure morphogenesis
GO:0051716	0.922	cellular response to stimulus
GO:0007229	0.911	integrin-mediated signaling pathway
GO:0030154	0.908	cell differentiation
GO:0016043	0.901	cellular component organization
GO:0048870	0.842	cell motility
GO:0007369	0.807	gastrulation
GO:0048646	0.778	anatomical structure formation involved in morphogenesis
GO:0044085	0.760	cellular component biogenesis
GO:0022607	0.741	cellular component assembly
GO:0016477	0.696	cell migration
GO:0001704	0.691	formation of primary germ layer
GO:0034330	0.663	cell junction organization
GO:0048731	0.601	system development
GO:0031589	0.573	cell-substrate adhesion
GO:0048518	0.542	positive regulation of biological process
GO:0009888	0.516	tissue development
GO:0048522	0.476	positive regulation of cellular process
GO:0048513	0.466	animal organ development
GO:0048468	0.407	cell development
GO:0008152	0.374	metabolic process
GO:0034329	0.348	cell junction assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.999	cell junction
GO:0005886	0.999	plasma membrane
GO:0012505	0.997	endomembrane system
GO:0031981	0.996	nuclear lumen
GO:0032991	0.995	protein-containing complex
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005737	0.979	cytoplasm
GO:0031975	0.975	envelope
GO:0031090	0.972	organelle membrane
GO:0005576	0.970	extracellular region
GO:0005635	0.965	nuclear envelope
GO:0031965	0.964	nuclear membrane
GO:0030055	0.949	cell-substrate junction
GO:0098636	0.945	protein complex involved in cell adhesion
GO:0005730	0.933	nucleolus
GO:0043235	0.929	receptor complex
GO:0009986	0.885	cell surface
GO:0031982	0.881	vesicle
GO:0098796	0.879	membrane protein complex
GO:0005615	0.859	extracellular space
GO:0065010	0.838	extracellular membrane-bounded organelle
GO:1903561	0.821	extracellular vesicle
GO:0070062	0.807	extracellular exosome
GO:0098797	0.752	plasma membrane protein complex
GO:0008305	0.741	integrin complex
GO:0062023	0.622	collagen-containing extracellular matrix
GO:0005925	0.597	focal adhesion
GO:0030056	0.562	hemidesmosome
GO:0005654	0.432	nucleoplasm
GO:0098590	0.322	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]