StarFunc result for job id P16150

User Input

>input (400 residues)
MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGD
QTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPI
TANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSK
GTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNA
STVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVV
DAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEE
LKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16150	1.000	1.000	2.915E-50	400	1.000	1.000	P16150.pdb.gz	LEUK_HUMAN Leukosialin OS=Homo sapiens OX=9606 GN=SPN PE=1 SV=1
2	AFDB:A0A0G2K6F9	0.102	0.076	3.911E-2	575	0.152	0.106	A0A0G2K6F9.pdb.gz	A0A0G2K6F9_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=2
3	AFDB:Q12215	0.102	0.078	4.192E-2	556	0.190	0.137	Q12215.pdb.gz	WSC3_YEAST Cell wall integrity and stress response component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=WSC3 PE=1 SV=1
4	AFDB:A0A0G2K069	0.092	0.065	4.817E-2	624	0.165	0.106	A0A0G2K069.pdb.gz	A0A0G2K069_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
5	AFDB:Q9VMU5	0.096	0.062	8.998E-2	721	0.175	0.097	Q9VMU5.pdb.gz	QTC_DROME Protein quick-to-court OS=Drosophila melanogaster OX=7227 GN=qtc PE=2 SV=2
6	AFDB:Q62036	0.077	0.033	1.108E-1	1060	0.198	0.075	Q62036.pdb.gz	CP131_MOUSE Centrosomal protein of 131 kDa OS=Mus musculus OX=10090 GN=Cep131 PE=1 SV=2
7	AFDB:O44783	0.076	0.058	1.802E-1	589	0.155	0.105	O44783.pdb.gz	SPY_DROME Protein sprouty OS=Drosophila melanogaster OX=7227 GN=sty PE=1 SV=2
8	AFDB:Q9W266	0.109	0.071	1.802E-1	677	0.165	0.097	Q9W266.pdb.gz	WDP_DROME Protein windpipe OS=Drosophila melanogaster OX=7227 GN=wdp PE=1 SV=1
9	AFDB:A0A2R8QB31	0.097	0.056	2.070E-1	797	0.163	0.082	A0A2R8QB31.pdb.gz	A0A2R8QB31_DANRE PHD finger protein 21A isoform X7 OS=Danio rerio OX=7955 GN=phf21ab PE=1 SV=1
10	AFDB:F4JP52	0.082	0.050	2.379E-1	826	0.165	0.080	F4JP52.pdb.gz	PQT3_ARATH E3 ubiquitin ligase PARAQUAT TOLERANCE 3 OS=Arabidopsis thaliana OX=3702 GN=PQT3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16150	0.0	767	400	1.000	1.000	LEUK_HUMAN Leukosialin OS=Homo sapiens OX=9606 GN=SPN PE=1 SV=1
2	P15702	9.08e-74	237	395	0.495	0.501	LEUK_MOUSE Leukosialin OS=Mus musculus OX=10090 GN=Spn PE=1 SV=1
3	P13838	1.07e-71	231	378	0.492	0.521	LEUK_RAT Leukosialin (Fragment) OS=Rattus norvegicus OX=10116 GN=Spn PE=1 SV=1
4	A2ARZ3	0.001	43.5	6995	0.125	0.007	FSIP2_MOUSE Fibrous sheath-interacting protein 2 OS=Mus musculus OX=10090 GN=Fsip2 PE=1 SV=3
5	Q94269	0.005	41.6	2314	0.090	0.016	Q94269_CAEEL Carboxypeptidase OS=Caenorhabditis elegans OX=6239 GN=ctsa-2 PE=1 SV=2
6	Q9EPF2	0.25	36.2	648	0.080	0.049	MUC18_RAT Cell surface glycoprotein MUC18 OS=Rattus norvegicus OX=10116 GN=Mcam PE=1 SV=2
7	P04821	0.49	35.4	1589	0.083	0.021	CDC25_YEAST Cell division control protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC25 PE=1 SV=1
8	Q8WWV6	0.49	35.0	532	0.077	0.058	FCAMR_HUMAN High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor OS=Homo sapiens OX=9606 GN=FCAMR PE=1 SV=1
9	M9MRD6	1.1	34.3	11999	0.085	0.003	M9MRD6_DROME Muscle-specific protein 300 kDa, isoform I OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
10	M9MRF5	1.1	34.3	11986	0.085	0.003	M9MRF5_DROME Muscle-specific protein 300 kDa, isoform H OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
11	M9PCM8	1.1	34.3	11917	0.085	0.003	M9PCM8_DROME Muscle-specific protein 300 kDa, isoform K OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
12	M9MRD1	1.3	33.9	12345	0.085	0.003	MS300_DROME Muscle-specific protein 300 kDa OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
13	M9PC84	1.3	33.9	12308	0.085	0.003	M9PC84_DROME Muscle-specific protein 300 kDa, isoform L OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
14	M9PC23	2.1	33.1	7962	0.085	0.004	M9PC23_DROME Muscle-specific protein 300 kDa, isoform J OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
15	O88783	2.3	33.1	2183	0.077	0.014	FA5_MOUSE Coagulation factor V OS=Mus musculus OX=10090 GN=F5 PE=1 SV=1
16	Q8IIK5	4.8	32.0	1201	0.120	0.040	Q8IIK5_PLAF7 Rhoptry neck protein 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1116000 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07584 BatA	58	15.4	Aerotolerance regulator N-terminal
2	PF14316 DUF4381	5e+02	12.3	Domain of unknown function (DUF4381)
3	PF01708 Gemini_mov	1.8e+02	13.3	Geminivirus putative movement protein
4	PF15681 LAX	92	13.3	Lymphocyte activation family X
5	PF15102 TMEM154	24	16.2	TMEM154 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353238

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331736	0.995	E-selectin
2	9606.ENSP00000356042	0.988	Ezrin
3	9606.ENSP00000264832	0.987	Intercellular adhesion molecule 1
4	9606.ENSP00000341141	0.980	Sialoadhesin
5	9606.ENSP00000353408	0.980	Moesin
6	9606.ENSP00000411355	0.917	Receptor-type tyrosine-protein phosphatase C
7	9606.ENSP00000342681	0.875	T-cell surface glycoprotein CD5
8	9606.ENSP00000333769	0.871	Basigin
9	9606.ENSP00000437256	0.869	Endoribonuclease Dicer
10	9606.ENSP00000384136	0.853	Radixin
11	9606.ENSP00000437940	0.843	B-lymphocyte antigen CD19
12	9606.ENSP00000356024	0.822	Complement receptor type 2
13	9606.ENSP00000312027	0.820	T-cell antigen CD7
14	9606.ENSP00000349252	0.804	Integrin alpha-L
15	9606.ENSP00000398632	0.803	CD44 antigen
16	9606.ENSP00000246006	0.800	Complement component C1q receptor
17	9606.ENSP00000011653	0.780	T-cell surface glycoprotein CD4
18	9606.ENSP00000221972	0.777	B-cell antigen receptor complex-associated protein alpha chain
19	9606.ENSP00000441691	0.753	Integrin alpha-M
20	9606.ENSP00000386559	0.742	T-cell surface glycoprotein CD8 alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004888	0.998	transmembrane signaling receptor activity
GO:0030544	0.997	Hsp70 protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0009987	0.992	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0048518	0.977	positive regulation of biological process
GO:0048523	0.977	negative regulation of cellular process
GO:1903557	0.974	positive regulation of tumor necrosis factor superfamily cytokine production
GO:0032502	0.965	developmental process
GO:0048856	0.964	anatomical structure development
GO:0042110	0.962	T cell activation
GO:0032680	0.940	regulation of tumor necrosis factor production
GO:0030097	0.939	hemopoiesis
GO:0045058	0.931	T cell selection
GO:0051707	0.929	response to other organism
GO:0051716	0.928	cellular response to stimulus
GO:0030155	0.927	regulation of cell adhesion
GO:0042221	0.923	response to chemical
GO:0006955	0.923	immune response
GO:0007165	0.917	signal transduction
GO:0022407	0.916	regulation of cell-cell adhesion
GO:0046631	0.889	alpha-beta T cell activation
GO:0006950	0.875	response to stress
GO:0050900	0.875	leukocyte migration
GO:0098609	0.862	cell-cell adhesion
GO:0002252	0.857	immune effector process
GO:0048522	0.835	positive regulation of cellular process
GO:0007159	0.817	leukocyte cell-cell adhesion
GO:0002684	0.808	positive regulation of immune system process
GO:0050776	0.800	regulation of immune response
GO:0006952	0.779	defense response
GO:0002263	0.764	cell activation involved in immune response
GO:0002366	0.611	leukocyte activation involved in immune response
GO:0007166	0.555	cell surface receptor signaling pathway
GO:0048584	0.549	positive regulation of response to stimulus
GO:0098542	0.541	defense response to other organism
GO:0002285	0.535	lymphocyte activation involved in immune response
GO:0002286	0.512	T cell activation involved in immune response
GO:0007162	0.508	negative regulation of cell adhesion
GO:0032760	0.500	positive regulation of tumor necrosis factor production
GO:0080090	0.353	regulation of primary metabolic process
GO:0051171	0.352	regulation of nitrogen compound metabolic process
GO:0008152	0.341	metabolic process
GO:0042742	0.340	defense response to bacterium
GO:0006935	0.337	chemotaxis
GO:0002694	0.332	regulation of leukocyte activation
GO:0002292	0.331	T cell differentiation involved in immune response
GO:0035710	0.330	CD4-positive, alpha-beta T cell activation
GO:0046632	0.327	alpha-beta T cell differentiation
GO:0002287	0.317	alpha-beta T cell activation involved in immune response
GO:0031323	0.316	regulation of cellular metabolic process
GO:0043367	0.314	CD4-positive, alpha-beta T cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	0.998	cell surface
GO:0043227	0.998	membrane-bounded organelle
GO:0005886	0.998	plasma membrane
GO:0005576	0.992	extracellular region
GO:0031982	0.986	vesicle
GO:0070062	0.983	extracellular exosome
GO:0005622	0.814	intracellular anatomical structure
GO:0043231	0.794	intracellular membrane-bounded organelle
GO:0005737	0.734	cytoplasm
GO:0031981	0.423	nuclear lumen
GO:0005654	0.392	nucleoplasm
GO:0012505	0.342	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]