StarFunc result for job id P16152

User Input

>input (277 residues)
MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFH
QLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRD
VCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTK
KGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKA
TKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16152	1.000	1.000	6.645E-59	277	1.000	1.000	P16152.pdb.gz	CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3
2	PDB:4z3dA	0.989	0.993	7.721E-54	276	0.996	1.000	4z3dA.pdb.gz	Structural insights on the catalytic site protection of human carbonyl reductase 1 by glutathione.
3	AFDB:P47727	0.991	0.991	1.330E-52	277	0.859	0.859	P47727.pdb.gz	CBR1_RAT Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus OX=10116 GN=Cbr1 PE=1 SV=2
4	AFDB:Q28960	0.988	0.947	4.295E-49	289	0.845	0.810	Q28960.pdb.gz	CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823 GN=CBR1 PE=1 SV=3
5	PDB:1n5dA	0.985	0.948	1.545E-47	288	0.841	0.809	1n5dA.pdb.gz	Porcine Carbonyl Reductase: Structural Basis for a Functional Monomer in Short-Chain Dehydrogenases/Reductases
6	AFDB:B2GV72	0.993	0.993	1.986E-47	277	0.733	0.733	B2GV72.pdb.gz	CRB3_RAT Carbonyl reductase [NADPH] 3 OS=Rattus norvegicus OX=10116 GN=Cbr3 PE=1 SV=1
7	AFDB:O75828	0.989	0.989	1.098E-46	277	0.718	0.718	O75828.pdb.gz	CBR3_HUMAN Carbonyl reductase [NADPH] 3 OS=Homo sapiens OX=9606 GN=CBR3 PE=1 SV=3
8	AFDB:Q9PT36	0.984	0.987	1.378E-42	276	0.603	0.605	Q9PT36.pdb.gz	Q9PT36_ONCMY carbonyl reductase (NADPH) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00007933001 PE=2 SV=1
9	PDB:2hrbA	0.938	0.952	2.915E-41	273	0.708	0.718	2hrbA.pdb.gz	Crystal Structure of human Carbonyl Reductase 3, complexed with NADP+
10	AFDB:Q9ZUH5	0.872	0.818	1.321E-24	296	0.361	0.338	Q9ZUH5.pdb.gz	SDR2B_ARATH Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana OX=3702 GN=SDR2b PE=1 SV=1
11	AFDB:F4JE70	0.886	0.813	1.996E-24	303	0.383	0.350	F4JE70.pdb.gz	F4JE70_ARATH Short-chain dehydrogenase/reductase OS=Arabidopsis thaliana OX=3702 GN=SDR1 PE=1 SV=1
12	AFDB:Q071N0	0.889	0.795	4.558E-24	311	0.357	0.318	Q071N0.pdb.gz	SALR_PAPSO Salutaridine reductase OS=Papaver somniferum OX=3469 GN=SALR PE=1 SV=1
13	AFDB:Q94K30	0.888	0.835	5.128E-24	295	0.372	0.349	Q94K30.pdb.gz	Q94K30_ARATH AT1G01800 protein OS=Arabidopsis thaliana OX=3702 GN=At1g01800 PE=1 SV=1
14	PDB:5l4sA	0.856	0.768	5.346E-23	310	0.357	0.319	5l4sA.pdb.gz	Pinpointing a Mechanistic Switch Between Ketoreduction and "Ene" Reduction in Short-Chain Dehydrogenases/Reductases.
15	PDB:3o26A	0.836	0.789	5.670E-23	294	0.354	0.333	3o26A.pdb.gz	The atomic structure of salutaridine reductase from the opium poppy Papaver somniferum.
16	PDB:6emmA	0.674	0.695	1.517E-14	268	0.231	0.239	6emmA.pdb.gz	X-ray Crystallographic Fragment screening and Hit Optimization
17	PDB:3o4rA	0.666	0.722	2.037E-14	254	0.242	0.264	3o4rA.pdb.gz	Crystal Structure of Human Dehydrogenase/Reductase (SDR family) member 4 (DHRS4)
18	PDB:2c07A	0.666	0.745	2.161E-14	246	0.195	0.220	2c07A.pdb.gz
19	PDB:3ndrA	0.674	0.750	2.431E-14	247	0.253	0.283	3ndrA.pdb.gz	Crystallization and preliminary X-ray analysis of SDR-type pyridoxal dehydrogenase from Mesorhizobium loti
20	PDB:1snyA	0.703	0.779	6.627E-14	248	0.220	0.246	1snyA.pdb.gz	Structural Insights into the Neuroprotective-acting Carbonyl Reductase Sniffer of Drosophila melanogaster.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16152	0.0	572	277	1.000	1.000	CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3
2	P48758	1.81e-180	499	277	0.877	0.877	CBR1_MOUSE Carbonyl reductase [NADPH] 1 OS=Mus musculus OX=10090 GN=Cbr1 PE=1 SV=3
3	Q28960	1.16e-174	485	289	0.845	0.810	CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa OX=9823 GN=CBR1 PE=1 SV=3
4	P47727	1.30e-172	479	277	0.859	0.859	CBR1_RAT Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus OX=10116 GN=Cbr1 PE=1 SV=2
5	B2GV72	2.63e-154	433	277	0.733	0.733	CRB3_RAT Carbonyl reductase [NADPH] 3 OS=Rattus norvegicus OX=10116 GN=Cbr3 PE=1 SV=1
6	O75828	8.19e-151	424	277	0.718	0.718	CBR3_HUMAN Carbonyl reductase [NADPH] 3 OS=Homo sapiens OX=9606 GN=CBR3 PE=1 SV=3
7	V9HW40	8.19e-151	424	277	0.718	0.718	V9HW40_HUMAN Carbonyl reductase (NADPH) OS=Homo sapiens OX=9606 GN=HEL-S-25 PE=1 SV=1
8	Q9PT36	3.80e-114	331	276	0.603	0.605	Q9PT36_ONCMY carbonyl reductase (NADPH) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00007933001 PE=2 SV=1
9	Q9PT38	1.01e-112	327	276	0.599	0.601	Q9PT38_ONCMY carbonyl reductase (NADPH) OS=Oncorhynchus mykiss OX=8022 PE=3 SV=1
10	F4JE70	3.01e-46	159	303	0.404	0.370	F4JE70_ARATH Short-chain dehydrogenase/reductase OS=Arabidopsis thaliana OX=3702 GN=SDR1 PE=1 SV=1
11	Q9ZUH5	2.93e-43	151	296	0.375	0.351	SDR2B_ARATH Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana OX=3702 GN=SDR2b PE=1 SV=1
12	Q94K30	3.05e-43	150	295	0.379	0.356	Q94K30_ARATH AT1G01800 protein OS=Arabidopsis thaliana OX=3702 GN=At1g01800 PE=1 SV=1
13	Q071N0	1.21e-39	142	311	0.379	0.338	SALR_PAPSO Salutaridine reductase OS=Papaver somniferum OX=3469 GN=SALR PE=1 SV=1
14	Q6WAU1	2.11e-28	112	314	0.365	0.322	IPIPR_MENPI (-)-isopiperitenone reductase OS=Mentha piperita OX=34256 PE=1 SV=1
15	Q7K0F7	2.47e-18	85.5	355	0.314	0.245	Q7K0F7_DROME Carbonyl reductase, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11200 PE=1 SV=1
16	O80924	5.02e-13	70.1	321	0.278	0.240	O80924_ARATH NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At2g37540 PE=1 SV=1
17	D2WKD9	5.46e-12	66.2	245	0.256	0.290	SDR1_AEDAE Farnesol dehydrogenase OS=Aedes aegypti OX=7159 GN=SDR-1 PE=1 SV=2
18	Q9P7B4	7.04e-12	66.2	259	0.177	0.189	YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC521.03 PE=1 SV=1
19	Q9ERI6	9.95e-12	66.6	334	0.303	0.251	RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus OX=10090 GN=Rdh14 PE=1 SV=1
20	Q8CEE7	2.08e-11	65.5	334	0.278	0.231	RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus OX=10090 GN=Rdh13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00106 adh_short	1e-29	114.9	short chain dehydrogenase
2	PF13561 adh_short_C2	4.9e-21	86.9	Enoyl-(Acyl carrier protein) reductase
3	PF01370 Epimerase	0.99	20.4	NAD dependent epimerase/dehydratase family
4	PF08659 KR	0.00094	30.6	KR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290349

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000234454	0.973	Sepiapterin reductase
2	9606.ENSP00000396308	0.973	Dihydrofolate reductase
3	9606.ENSP00000369927	0.970	Aldo-keto reductase family 1 member C3
4	9606.ENSP00000285930	0.957	Aldose reductase
5	9606.ENSP00000342385	0.943	Prostaglandin E synthase
6	9606.ENSP00000345341	0.937	Prostaglandin E synthase 2
7	9606.ENSP00000337915	0.929	Cytochrome P450 3A4
8	9606.ENSP00000482075	0.929	Prostaglandin E synthase 3
9	9606.ENSP00000369050	0.923	Cytochrome P450 1A1
10	9606.ENSP00000353820	0.915	Cytochrome P450 2D6
11	9606.ENSP00000301141	0.910	Cytochrome P450 2A6
12	9606.ENSP00000352584	0.910	Aldo-keto reductase family 1 member B10
13	9606.ENSP00000440689	0.910	Cytochrome P450 2E1
14	9606.ENSP00000332679	0.908	Cytochrome P450 2A13
15	9606.ENSP00000377768	0.908	Dihydrofolate reductase 2, mitochondrial
16	9606.ENSP00000280362	0.903	6-pyruvoyl tetrahydrobiopterin synthase
17	9606.ENSP00000290354	0.898	Carbonyl reductase [NADPH] 3
18	9606.ENSP00000244217	0.780	Methylmalonyl-CoA epimerase, mitochondrial
19	9606.ENSP00000361140	0.755	Alcohol dehydrogenase [NADP(+)]
20	9606.ENSP00000320401	0.747	UDP-glucuronosyltransferase 2B17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004090	0.998	carbonyl reductase (NADPH) activity
GO:0005488	0.994	binding
GO:0005515	0.941	protein binding
GO:0016651	0.775	oxidoreductase activity, acting on NAD(P)H
GO:0016655	0.699	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
GO:0097159	0.574	organic cyclic compound binding
GO:1901363	0.458	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0006629	0.979	lipid metabolic process
GO:1901360	0.978	organic cyclic compound metabolic process
GO:0044281	0.920	small molecule metabolic process
GO:0008202	0.916	steroid metabolic process
GO:0019752	0.569	carboxylic acid metabolic process
GO:0050896	0.547	response to stimulus
GO:0065007	0.537	biological regulation
GO:0051716	0.428	cellular response to stimulus
GO:0032787	0.422	monocarboxylic acid metabolic process
GO:0044255	0.405	cellular lipid metabolic process
GO:0050789	0.372	regulation of biological process
GO:0042221	0.361	response to chemical
GO:0050794	0.341	regulation of cellular process
GO:0009058	0.331	biosynthetic process
GO:0070887	0.328	cellular response to chemical stimulus
GO:0006631	0.323	fatty acid metabolic process
GO:1901576	0.319	organic substance biosynthetic process
GO:0044249	0.318	cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0005634	0.982	nucleus
GO:0016020	0.977	membrane
GO:0070062	0.977	extracellular exosome
GO:0070013	0.922	intracellular organelle lumen
GO:0005654	0.735	nucleoplasm
GO:0071944	0.351	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19257	0.998	a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH
EC:1.1.1.184	0.998	carbonyl reductase (NADPH).
EC:1.6.-.-	0.775	Acting on NADH or NADPH.
EC:1.6.5.-	0.699	With a quinone or similar compound as acceptor.

[back to server]