StarFunc result for job id P16157

User Input

>input (1881 residues)
MPYSVGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKM
VVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQ
ENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIA
ARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGI
TPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQA
KTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDK
GAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIV
KNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARI
GHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPL
HVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAW
NGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQAN
GNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFL
LQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYI
SVTDVLKVVTDETSFVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEE
KELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSD
NISPVASPVHTGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLS
TPPPLAEEEGLASRIIALGPTGAQFLSPVIVEIPHFASHGRGDRELVVLRSENGSVWKEH
RSRYGESYLDQILNGMDEELGSLEELEKKRVCRIITTDFPLYFVIMSRLCQDYDTIGPEG
GSLKSKLVPLVQATFPENAVTKRVKLALQAQPVPDELVTKLLGNQATFSPIVTVEPRRRK
FHRPIGLRIPLPPSWTDNPRDSGEGDTTSLRLLCSVIGGTDQAQWEDITGTTKLVYANEC
ANFTTNVSARFWLSDCPRTAEAVNFATLLYKELTAVPYMAKFVIFAKMNDPREGRLRCYC
MTDDKVDKTLEQHENFVEVARSRDIEVLEGMSLFAELSGNLVPVKKAAQQRSFHFQSFRE
NRLAMPVKVRDSSREPGGSLSFLRKAMKYEDTQHILCHLNITMPPCAKGSGAEDRRRTPT
PLALRYSILSESTPGSLSGTEQAEMKMAVISEHLGLSWAELARELQFSVEDINRIRVENP
NSLLEQSVALLNLWVIREGQNANMENLYTALQSIDRGEIVNMLEGSGRQSRNLKPDRRHT
DRDYSLSPSQMNGYSSLQDELLSPASLGCALSSPLRADQYWNEVAVLDAIPLAATEHDTM
LEMSDMQVWSAGLTPSLVTAEDSSLECSKAEDSDATGHEWKLEGALSEEPRGPELGSLEL
VEDDTVDSDATNGLIDLLEQEEGQRSEEKLPGSKRQDDATGAGQDSENEVSLVSGHQRGQ
ARITHSPTVSQVTERSQDRLQDWDADGSIVSYLQDAAQGSWQEEVTQGPHSFQGTSTMTE
GLEPGGSQEYEKVLVSVSEHTWTEQPEAESSQADRDRRQQGQEEQVQEAKNTFTQVVQGN
EFQNIPGEQVTEEQFTDEQGNIVTKKIIRKVVRQIDLSSADAAQEHEEVTVEGPLEDPSE
LEVDIDYFMKHSKDHTSTPNP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5E8K5	0.394	0.379	0.000	1961	0.528	0.506	G5E8K5.pdb.gz	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
2	AFDB:O70511	0.524	0.396	0.000	2622	0.499	0.358	O70511.pdb.gz	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
3	AFDB:P16157	1.000	1.000	0.000	1881	1.000	1.000	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
4	AFDB:Q0KIE7	0.411	0.496	0.000	1549	0.375	0.456	Q0KIE7.pdb.gz	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
5	AFDB:Q9NCP8	0.429	0.669	9.364E-87	1159	0.315	0.512	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
6	PDB:8cs9A	0.341	0.772	4.314E-84	796	0.423	0.999	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
7	AFDB:A0A5F9ZH18	0.247	0.412	6.554E-61	1109	0.245	0.415	A0A5F9ZH18.pdb.gz	A0A5F9ZH18_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
8	AFDB:Q3T1J5	0.246	0.508	2.912E-57	880	0.221	0.473	Q3T1J5.pdb.gz	Q3T1J5_RAT Ank3 protein OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=1
9	AFDB:Q5TYL6	0.232	0.472	9.685E-47	905	0.144	0.298	Q5TYL6.pdb.gz	Q5TYL6_CAEEL ZU5 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
10	AFDB:Q3KN55	0.265	0.688	3.576E-42	697	0.170	0.458	Q3KN55.pdb.gz	Q3KN55_DROME Ankyrin 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
11	AFDB:O75179	0.260	0.194	8.164E-42	2603	0.209	0.151	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
12	PDB:5vkqA	0.292	0.352	6.394E-31	1499	0.137	0.172	5vkqA.pdb.gz
13	PDB:4oauC	0.141	0.367	7.922E-11	692	0.046	0.126	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.112	0.846	2.576E-9	229	0.036	0.297	2dvwA.pdb.gz
15	PDB:6v9hC	0.114	0.746	8.420E-9	270	0.039	0.270	6v9hC.pdb.gz
16	PDB:6aunA	0.126	0.334	1.665E-8	618	0.045	0.138	6aunA.pdb.gz
17	PDB:1wg0A	0.106	0.784	9.667E-8	243	0.034	0.263	1wg0A.pdb.gz
18	PDB:6mwqA	0.081	0.285	1.377E-6	493	0.050	0.191	6mwqA.pdb.gz
19	PDB:6pqpA	0.100	0.281	2.275E-6	615	0.053	0.163	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
20	PDB:6jd6B	0.083	0.786	4.500E-6	192	0.026	0.255	6jd6B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WTF3	644	1643	0.163	0.187	A0A087WTF3_HUMAN Ankyrin 3 (Fragment) OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=1
2	A0A087WZ65	640	973	0.176	0.340	A0A087WZ65_HUMAN Ankyrin 3 (Fragment) OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=1
3	A0A0G2JZ56	1725	4013	0.456	0.214	A0A0G2JZ56_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
4	A0A0G2K6R9	1724	3998	0.455	0.214	A0A0G2K6R9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
5	A0A0G2KAS9	1744	3980	0.456	0.215	A0A0G2KAS9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
6	A0A0G2KBB9	1691	4017	0.444	0.208	A0A0G2KBB9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
7	A0A5F9ZGS5	1822	1871	0.485	0.487	A0A5F9ZGS5_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
8	A0A5F9ZGS7	1796	1827	0.483	0.498	A0A5F9ZGS7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
9	A0A5F9ZGX3	1731	3972	0.453	0.215	A0A5F9ZGX3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
10	A0A5F9ZGX8	1806	1830	0.485	0.498	A0A5F9ZGX8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
11	A0A5F9ZGY1	1796	1887	0.484	0.482	A0A5F9ZGY1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
12	A0A5F9ZGY3	1747	3934	0.453	0.217	A0A5F9ZGY3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	A0A5F9ZGY4	1748	3848	0.453	0.221	A0A5F9ZGY4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	A0A5F9ZGZ1	1795	1943	0.483	0.468	A0A5F9ZGZ1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	A0A5F9ZGZ5	1747	3874	0.453	0.220	A0A5F9ZGZ5_HUMAN Ankyrin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZH03	1652	1785	0.450	0.474	A0A5F9ZH03_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZH10	746	1005	0.214	0.400	A0A5F9ZH10_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZH17	1644	1879	0.450	0.450	A0A5F9ZH17_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZH18	756	1109	0.214	0.362	A0A5F9ZH18_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZH19	1754	3895	0.453	0.219	A0A5F9ZH19_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.5e-134	444.6	Ankyrin repeat
2	PF12796 Ank_2	5.2e-150	499.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.7e-116	376.6	Ankyrin repeat
4	PF13637 Ank_4	7.9e-126	420.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	9.2e-122	406.8	Ankyrin repeats (many copies)
6	PF00531 Death	1.8e-22	90.6	Death domain
7	PF17809 UPA_2	3.7e-55	196.7	UPA domain
8	PF00791 ZU5	1.4e-30	116.7	ZU5 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008975172.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003807546.1	0.999	Belongs to the integrin alpha chain family.
2	9597.XP_003824086.1	0.984	Belongs to the spectrin family.
3	9597.XP_008961940.1	0.952	Obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF
4	9597.XP_008953651.1	0.925	Ankyrin-2 isoform X1
5	9597.XP_003821230.1	0.910	Ankyrin 3
6	9597.XP_003830420.1	0.889	CD44 molecule (Indian blood group)
7	9597.XP_008961805.1	0.883	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 ESTs, and 100% coverage of the annotated genomic feature by RNAseq alignments
8	9597.XP_008954853.1	0.846	Inositol 1,4,5-trisphosphate receptor type 1 isoform X1
9	9597.XP_003828957.2	0.832	Inositol 1,4,5-trisphosphate receptor type 2
10	9597.XP_008958869.1	0.831	Inositol 1,4,5-trisphosphate receptor type 3 isoform X1
11	9597.XP_008974812.1	0.822	Neurofascin isoform X1
12	9597.XP_003813268.1	0.819	T-lymphoma invasion and metastasis-inducing protein 1 isoform X1
13	9597.XP_003821039.2	0.814	Spectrin alpha, erythrocytic 1
14	9597.XP_003833228.1	0.807	Belongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily
15	9597.XP_008963213.1	0.807	Belongs to the spectrin family.
16	9597.XP_003805920.1	0.804	Solute carrier family 4 member 1 (Diego blood group)
17	9597.XP_008960841.1	0.772	Transient receptor potential cation channel subfamily V member 1
18	9597.XP_008966737.1	0.734	Titin
19	9597.XP_008963948.1	0.702	Transient receptor potential cation channel subfamily M member 8
20	9597.XP_003830884.1	0.685	Belongs to the spectrin family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005200	0.758	structural constituent of cytoskeleton
GO:0008092	0.582	cytoskeletal protein binding
GO:0051117	0.521	ATPase binding
GO:0030507	0.515	spectrin binding
GO:0019903	0.495	protein phosphatase binding
GO:0008093	0.479	cytoskeletal anchor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0048518	0.976	positive regulation of biological process
GO:0048522	0.952	positive regulation of cellular process
GO:0009987	0.933	cellular process
GO:0051130	0.721	positive regulation of cellular component organization
GO:0033043	0.656	regulation of organelle organization
GO:0010638	0.645	positive regulation of organelle organization
GO:0051179	0.467	localization
GO:0051234	0.407	establishment of localization
GO:0006810	0.370	transport
GO:0050896	0.363	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043229	0.999	intracellular organelle
GO:0005737	0.998	cytoplasm
GO:0012505	0.996	endomembrane system
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0005634	0.939	nucleus
GO:0005783	0.744	endoplasmic reticulum
GO:0042995	0.619	cell projection
GO:0120025	0.585	plasma membrane bounded cell projection
GO:0043005	0.573	neuron projection
GO:0030054	0.568	cell junction
GO:0005829	0.525	cytosol
GO:0098590	0.510	plasma membrane region
GO:0030424	0.462	axon
GO:0045202	0.446	synapse
GO:0099080	0.408	supramolecular complex
GO:0005856	0.399	cytoskeleton
GO:0070013	0.392	intracellular organelle lumen
GO:0014731	0.374	spectrin-associated cytoskeleton
GO:0031981	0.366	nuclear lumen
GO:0099512	0.352	supramolecular fiber
GO:0030016	0.339	myofibril
GO:0044304	0.338	main axon
GO:0030017	0.326	sarcomere
GO:0031674	0.308	I band
GO:0097060	0.304	synaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]